NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148298760|ref|NP_694498.2|]
View 

homogentisate 1,2-dioxygenase

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
hmgA TIGR01015
homogentisate 1,2-dioxygenase; Missing in human disease alkaptonuria. [Energy metabolism, ...
4-434 0e+00

homogentisate 1,2-dioxygenase; Missing in human disease alkaptonuria. [Energy metabolism, Amino acids and amines]


:

Pssm-ID: 273395  Cd Length: 429  Bit Score: 853.28  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760    4 LKYMSGFGNEFSSEdpRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWLYRILPSVRHKPFTRM--SCGDL 81
Cdd:TIGR01015   2 LKYLSGFGNEFESE--RVPGALPVGQNSPQKCPYGLYAEQLSGSAFTAPRHENKRSWLYRIRPSAAHEPFEPRdgNPGHV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760   82 TENWNEVEPDPNQLRWKPFNIPksSEKKVDFVSGLHTVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQQG 161
Cdd:TIGR01015  80 TANFDEQAPDPNQLRWSPFPIP--SDEAVDFVDGLHTLCGAGDATSRTGLAIHIYLCNASMENRAFYNADGDFLIVPQQG 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  162 EILITTEFGKMMVEPNEICVIQQGMRFSVDVFGETRGYILEVFGAHFELPDLGPIGANGLANPRDFQTPVAWYEDRTIAT 241
Cdd:TIGR01015 158 ALLITTEFGRLLVEPNEICVIPRGVRFRVTVLEPARGYICEVYGAHFQLPDLGPIGANGLANPRDFEAPVAAFEDREVPG 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  242 GYTIVNKYQGKLFSCQQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLTAKSTRPGVAIADFVIFPPR 321
Cdd:TIGR01015 238 PYTVINKFQGSLFAAKQDHSPFDVVAWHGNYVPYKYDLKRFNVINSVSFDHPDPSIFTVLTAPSDRPGTAIADFVIFPPR 317
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  322 WGVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDVDCFEKNSTALLKPERVAEGTMAFMFE 401
Cdd:TIGR01015 318 WLVAEKTFRPPYYHRNCMSEFMGLITGAYDAKEGGFVPGGGSLHNMMTPHGPDFDCFEKASNAKLKPERIADGTMAFMFE 397
                         410       420       430
                  ....*....|....*....|....*....|...
gi 148298760  402 SSFSMAVTKWGLeTCQRLDKNYYKCWEALKSHF 434
Cdd:TIGR01015 398 SSLSLAVTKWGA-TCQKLQEDYYKCWQPLKRHF 429
 
Name Accession Description Interval E-value
hmgA TIGR01015
homogentisate 1,2-dioxygenase; Missing in human disease alkaptonuria. [Energy metabolism, ...
4-434 0e+00

homogentisate 1,2-dioxygenase; Missing in human disease alkaptonuria. [Energy metabolism, Amino acids and amines]


Pssm-ID: 273395  Cd Length: 429  Bit Score: 853.28  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760    4 LKYMSGFGNEFSSEdpRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWLYRILPSVRHKPFTRM--SCGDL 81
Cdd:TIGR01015   2 LKYLSGFGNEFESE--RVPGALPVGQNSPQKCPYGLYAEQLSGSAFTAPRHENKRSWLYRIRPSAAHEPFEPRdgNPGHV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760   82 TENWNEVEPDPNQLRWKPFNIPksSEKKVDFVSGLHTVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQQG 161
Cdd:TIGR01015  80 TANFDEQAPDPNQLRWSPFPIP--SDEAVDFVDGLHTLCGAGDATSRTGLAIHIYLCNASMENRAFYNADGDFLIVPQQG 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  162 EILITTEFGKMMVEPNEICVIQQGMRFSVDVFGETRGYILEVFGAHFELPDLGPIGANGLANPRDFQTPVAWYEDRTIAT 241
Cdd:TIGR01015 158 ALLITTEFGRLLVEPNEICVIPRGVRFRVTVLEPARGYICEVYGAHFQLPDLGPIGANGLANPRDFEAPVAAFEDREVPG 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  242 GYTIVNKYQGKLFSCQQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLTAKSTRPGVAIADFVIFPPR 321
Cdd:TIGR01015 238 PYTVINKFQGSLFAAKQDHSPFDVVAWHGNYVPYKYDLKRFNVINSVSFDHPDPSIFTVLTAPSDRPGTAIADFVIFPPR 317
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  322 WGVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDVDCFEKNSTALLKPERVAEGTMAFMFE 401
Cdd:TIGR01015 318 WLVAEKTFRPPYYHRNCMSEFMGLITGAYDAKEGGFVPGGGSLHNMMTPHGPDFDCFEKASNAKLKPERIADGTMAFMFE 397
                         410       420       430
                  ....*....|....*....|....*....|...
gi 148298760  402 SSFSMAVTKWGLeTCQRLDKNYYKCWEALKSHF 434
Cdd:TIGR01015 398 SSLSLAVTKWGA-TCQKLQEDYYKCWQPLKRHF 429
HgmA pfam04209
homogentisate 1,2-dioxygenase; Homogentisate dioxygenase cleaves the aromatic ring during the ...
5-434 0e+00

homogentisate 1,2-dioxygenase; Homogentisate dioxygenase cleaves the aromatic ring during the metabolic degradation of Phe and Tyr. Homogentisate dioxygenase deficiency causes alkaptonuria. The structure of homogentisate dioxygenase shows that the enzyme forms a hexamer arrangement comprised of a dimer of trimers. The active site iron ion is coordinated near the interface between the trimers.


Pssm-ID: 252454  Cd Length: 422  Bit Score: 761.96  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760    5 KYMSGFGNEFSSEdpRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWLYRILPSVRHKPFTRMSCGDLTEN 84
Cdd:pfam04209   1 KYLTGFGNEFSSE--AHPGALPVGQNSPQKCPYGLYAEQLSGSAFTAPRHTNQRSWLYRIRPSAAHEPFFPRKGQHKTAE 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760   85 WNEVEPDPNQLRWKPFNIPksSEKKVDFVSGLHTVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQQGEIL 164
Cdd:pfam04209  79 FSEWHPDPNQLRWKPLPLP--SKEPTDFVEGLHTIAGAGDPLSNHGLAIHVYSANKSMENKLFYNADGDFLIVPQQGELD 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  165 ITTEFGKMMVEPNEICVIQQGMRFSVDVFGETRGYILEVFGAHFELPDLGPIGANGLANPRDFQTPVAWYEDRTiaTGYT 244
Cdd:pfam04209 157 LYTEFGRLEVSPGEIAVIPRGTRFRVEVIGPARGYICENYGAHFQLPDLGPIGANGLANPRDFKAPVAAYEDEE--TPYQ 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  245 IVNKYQGKLFSCQQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLTAKSTRPGVAIADFVIFPPRWGV 324
Cdd:pfam04209 235 VIVKFQGKLFTAEQDHSPLDVVAWHGNYVPYKYDLSRFNPINSVSFDHPDPSIFTVLTAPSVEPGTANADFVIFPPRWLV 314
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  325 ADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDVDCFEKNSTALLKPERVAEgTMAFMFESSF 404
Cdd:pfam04209 315 AEHTFRPPYYHRNCMSEFMGLIRGNYEAKEEGFVPGGASLHNCMTPHGPDASAFEKASNADLKPTKIDE-TMAFMFETRL 393
                         410       420       430
                  ....*....|....*....|....*....|
gi 148298760  405 SMAVTKWGLEtCQRLDKNYYKCWEALKSHF 434
Cdd:pfam04209 394 PLQVTDWAKE-SENLQPDYYKCWQGLKSHF 422
PRK05341 PRK05341
homogentisate 1,2-dioxygenase; Provisional
1-437 0e+00

homogentisate 1,2-dioxygenase; Provisional


Pssm-ID: 235421  Cd Length: 438  Bit Score: 732.83  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760   1 MAGLKYMSGFGNEFSSEdpRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWLYRILPSVRHKPFTRMSCGd 80
Cdd:PRK05341   9 ANTLGYQSGFGNEFATE--ALPGALPVGQNSPQRAPYGLYAEQLSGTAFTAPRAENRRSWLYRIRPSVVHGPFEPVDSR- 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  81 LTENWNEVEPDPNQLRWKPFNIPkssEKKVDFVSGLHTVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQQ 160
Cdd:PRK05341  86 LWRTFDEVPTPPNQLRWDPLPLP---AEPTDFVDGLVTMAGNGDAEAQAGMAIHLYAANRSMQDRYFYNADGELLIVPQQ 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 161 GEILITTEFGKMMVEPNEICVIQQGMRFSVDVF-GETRGYILEVFGAHFELPDLGPIGANGLANPRDFQTPVAWYEDRti 239
Cdd:PRK05341 163 GRLRLATELGVLDVEPGEIAVIPRGVKFRVELPdGPARGYVCENYGAPFRLPDLGPIGANGLANPRDFLTPVAAFEDR-- 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 240 ATGYTIVNKYQGKLFSCQQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLTAKSTRPGVAIADFVIFP 319
Cdd:PRK05341 241 EGPFELVAKFGGRLWRAEIDHSPLDVVAWHGNYAPYKYDLRRFNTIGSISFDHPDPSIFTVLTSPSDTPGTANIDFVIFP 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 320 PRWGVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDVDCFEKNSTALLKPERVaEGTMAFM 399
Cdd:PRK05341 321 PRWLVAENTFRPPWFHRNVMSEFMGLIHGVYDAKAEGFVPGGASLHNCMSPHGPDAETFEKASNADLKPHKI-DNTMAFM 399
                        410       420       430
                 ....*....|....*....|....*....|....*...
gi 148298760 400 FESSFSMAVTKWGLETCQRlDKNYYKCWEALKSHFNPN 437
Cdd:PRK05341 400 FETRYPIRPTRFALETPQL-QADYDDCWQGLKKHFDPE 436
PLN02658 PLN02658
homogentisate 1,2-dioxygenase
6-434 0e+00

homogentisate 1,2-dioxygenase


Pssm-ID: 215355  Cd Length: 435  Bit Score: 709.94  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760   6 YMSGFGNEFSSEdpRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWLYRILPSVRHKPFTRMS------CG 79
Cdd:PLN02658   1 YQSGFGNHFSSE--ALPGALPRGQNNPLLCPYGLYAEQLSGTAFTAPRKLNRRSWLYRIKPSVTHEPFKPRVpaheklVG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  80 DLTENWNeVEPDPNQLRWKPFNIPkssEKKVDFVSGLHTVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQ 159
Cdd:PLN02658  79 EFDPSNS-CETTPTQLRWRPFPVP---DSPVDFVDGLFTVCGAGSPFLRHGYAIHMYVANKSMDDCAFCNADGDFLIVPQ 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 160 QGEILITTEFGKMMVEPNEICVIQQGMRFSVDVF-GETRGYILEVFGAHFELPDLGPIGANGLANPRDFQTPVAWYEDRT 238
Cdd:PLN02658 155 QGRLWIKTELGKLQVSPGEIVVIPRGFRFAVDLPdGPSRGYVLEIFGGHFQLPDLGPIGANGLANPRDFLHPVAWFEDGS 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 239 IAtGYTIVNKYQGKLFSCQQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLTAKSTRPGVAIADFVIF 318
Cdd:PLN02658 235 RP-GYTIVQKFGGELFTAKQDFSPFNVVAWHGNYVPYKYDLSKFCPVNTVLFDHADPSINTVLTAPTDKPGVALADFVIF 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 319 PPRWGVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDVDCFEKN-STALLKPERVAEGTMA 397
Cdd:PLN02658 314 PPRWLVAEHTFRPPYYHRNCMSEFMGLIYGSYEAKADGFLPGGASLHSCMTPHGPDTATYEATiARPCADAPSKLTGTLA 393
                        410       420       430
                 ....*....|....*....|....*....|....*..
gi 148298760 398 FMFESSFSMAVTKWGLEtCQRLDKNYYKCWEALKSHF 434
Cdd:PLN02658 394 FMFESSLIPRVCPWALE-SPFRDRDYYQCWIGLKSHF 429
HmgA COG3508
Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport and catabolism];
4-436 0e+00

Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport and catabolism];


Pssm-ID: 226039  Cd Length: 427  Bit Score: 519.77  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760   4 LKYMSGFGNEFSSEDprCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWLYRILPSVRHKPFTRMSCGDLTE 83
Cdd:COG3508    3 ARYQSGFGNVFETEA--LPGALPVGQNSPQKAPYGLYAEQLSGSAFTAPRGENRRSWLYRIRPSANHPTFRPMKLGEWKS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  84 NWNEVEPDPNQLRWKPFNIPKSSEkkvDFVSGLHTVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQQGEI 163
Cdd:COG3508   81 ALIGPWATPNQLRWSPLPLPKAPT---DFLDGILLIANNGDADTQDGVAIHVYKVNESMTKRFFRNADGELLIVPQQGEL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 164 LITTEFGKMMVEPNEICVIQQGMRFSVDVF-GETRGYILEVFGAHFELPDLGPIGANGLANPRDFQTPVAWYEDRTiaTG 242
Cdd:COG3508  158 RLKTELGVLEVEPGEIAVIPRGTTFRVELKdGEARGYGCENYGAKFRLPELGPIGANGLANPRDFKTPVARYEDSE--GP 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 243 YTIVNKYQGKLFSCQQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLTAKSTRPGVAIADFVIFPPRW 322
Cdd:COG3508  236 TQLVVKTHGGLWAVELDHSPLDVVAWHGNLAPYKYDLRDFNPIGTISYDHPDPSIFTVLTAPSDTPGFANCDFVIFPPRW 315
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 323 GVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDVDCFEKNSTALLKPERVaEGTMAFMFES 402
Cdd:COG3508  316 LVAEQTFRPPWYHRNDMSEFMGLISGQYDAKAEGFVPGGASLHNCMSAHGPDPSAFEKALNARLKPHKI-DDTMAFMFET 394
                        410       420       430
                 ....*....|....*....|....*....|....
gi 148298760 403 SFSMAVTKWGLETCQRLDkNYYKCWEALkshFNP 436
Cdd:COG3508  395 RKVLRPSRYAAEIDALQD-DYDACWQGL---FNK 424
 
Name Accession Description Interval E-value
hmgA TIGR01015
homogentisate 1,2-dioxygenase; Missing in human disease alkaptonuria. [Energy metabolism, ...
4-434 0e+00

homogentisate 1,2-dioxygenase; Missing in human disease alkaptonuria. [Energy metabolism, Amino acids and amines]


Pssm-ID: 273395  Cd Length: 429  Bit Score: 853.28  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760    4 LKYMSGFGNEFSSEdpRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWLYRILPSVRHKPFTRM--SCGDL 81
Cdd:TIGR01015   2 LKYLSGFGNEFESE--RVPGALPVGQNSPQKCPYGLYAEQLSGSAFTAPRHENKRSWLYRIRPSAAHEPFEPRdgNPGHV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760   82 TENWNEVEPDPNQLRWKPFNIPksSEKKVDFVSGLHTVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQQG 161
Cdd:TIGR01015  80 TANFDEQAPDPNQLRWSPFPIP--SDEAVDFVDGLHTLCGAGDATSRTGLAIHIYLCNASMENRAFYNADGDFLIVPQQG 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  162 EILITTEFGKMMVEPNEICVIQQGMRFSVDVFGETRGYILEVFGAHFELPDLGPIGANGLANPRDFQTPVAWYEDRTIAT 241
Cdd:TIGR01015 158 ALLITTEFGRLLVEPNEICVIPRGVRFRVTVLEPARGYICEVYGAHFQLPDLGPIGANGLANPRDFEAPVAAFEDREVPG 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  242 GYTIVNKYQGKLFSCQQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLTAKSTRPGVAIADFVIFPPR 321
Cdd:TIGR01015 238 PYTVINKFQGSLFAAKQDHSPFDVVAWHGNYVPYKYDLKRFNVINSVSFDHPDPSIFTVLTAPSDRPGTAIADFVIFPPR 317
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  322 WGVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDVDCFEKNSTALLKPERVAEGTMAFMFE 401
Cdd:TIGR01015 318 WLVAEKTFRPPYYHRNCMSEFMGLITGAYDAKEGGFVPGGGSLHNMMTPHGPDFDCFEKASNAKLKPERIADGTMAFMFE 397
                         410       420       430
                  ....*....|....*....|....*....|...
gi 148298760  402 SSFSMAVTKWGLeTCQRLDKNYYKCWEALKSHF 434
Cdd:TIGR01015 398 SSLSLAVTKWGA-TCQKLQEDYYKCWQPLKRHF 429
HgmA pfam04209
homogentisate 1,2-dioxygenase; Homogentisate dioxygenase cleaves the aromatic ring during the ...
5-434 0e+00

homogentisate 1,2-dioxygenase; Homogentisate dioxygenase cleaves the aromatic ring during the metabolic degradation of Phe and Tyr. Homogentisate dioxygenase deficiency causes alkaptonuria. The structure of homogentisate dioxygenase shows that the enzyme forms a hexamer arrangement comprised of a dimer of trimers. The active site iron ion is coordinated near the interface between the trimers.


Pssm-ID: 252454  Cd Length: 422  Bit Score: 761.96  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760    5 KYMSGFGNEFSSEdpRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWLYRILPSVRHKPFTRMSCGDLTEN 84
Cdd:pfam04209   1 KYLTGFGNEFSSE--AHPGALPVGQNSPQKCPYGLYAEQLSGSAFTAPRHTNQRSWLYRIRPSAAHEPFFPRKGQHKTAE 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760   85 WNEVEPDPNQLRWKPFNIPksSEKKVDFVSGLHTVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQQGEIL 164
Cdd:pfam04209  79 FSEWHPDPNQLRWKPLPLP--SKEPTDFVEGLHTIAGAGDPLSNHGLAIHVYSANKSMENKLFYNADGDFLIVPQQGELD 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  165 ITTEFGKMMVEPNEICVIQQGMRFSVDVFGETRGYILEVFGAHFELPDLGPIGANGLANPRDFQTPVAWYEDRTiaTGYT 244
Cdd:pfam04209 157 LYTEFGRLEVSPGEIAVIPRGTRFRVEVIGPARGYICENYGAHFQLPDLGPIGANGLANPRDFKAPVAAYEDEE--TPYQ 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  245 IVNKYQGKLFSCQQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLTAKSTRPGVAIADFVIFPPRWGV 324
Cdd:pfam04209 235 VIVKFQGKLFTAEQDHSPLDVVAWHGNYVPYKYDLSRFNPINSVSFDHPDPSIFTVLTAPSVEPGTANADFVIFPPRWLV 314
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  325 ADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDVDCFEKNSTALLKPERVAEgTMAFMFESSF 404
Cdd:pfam04209 315 AEHTFRPPYYHRNCMSEFMGLIRGNYEAKEEGFVPGGASLHNCMTPHGPDASAFEKASNADLKPTKIDE-TMAFMFETRL 393
                         410       420       430
                  ....*....|....*....|....*....|
gi 148298760  405 SMAVTKWGLEtCQRLDKNYYKCWEALKSHF 434
Cdd:pfam04209 394 PLQVTDWAKE-SENLQPDYYKCWQGLKSHF 422
PRK05341 PRK05341
homogentisate 1,2-dioxygenase; Provisional
1-437 0e+00

homogentisate 1,2-dioxygenase; Provisional


Pssm-ID: 235421  Cd Length: 438  Bit Score: 732.83  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760   1 MAGLKYMSGFGNEFSSEdpRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWLYRILPSVRHKPFTRMSCGd 80
Cdd:PRK05341   9 ANTLGYQSGFGNEFATE--ALPGALPVGQNSPQRAPYGLYAEQLSGTAFTAPRAENRRSWLYRIRPSVVHGPFEPVDSR- 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  81 LTENWNEVEPDPNQLRWKPFNIPkssEKKVDFVSGLHTVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQQ 160
Cdd:PRK05341  86 LWRTFDEVPTPPNQLRWDPLPLP---AEPTDFVDGLVTMAGNGDAEAQAGMAIHLYAANRSMQDRYFYNADGELLIVPQQ 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 161 GEILITTEFGKMMVEPNEICVIQQGMRFSVDVF-GETRGYILEVFGAHFELPDLGPIGANGLANPRDFQTPVAWYEDRti 239
Cdd:PRK05341 163 GRLRLATELGVLDVEPGEIAVIPRGVKFRVELPdGPARGYVCENYGAPFRLPDLGPIGANGLANPRDFLTPVAAFEDR-- 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 240 ATGYTIVNKYQGKLFSCQQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLTAKSTRPGVAIADFVIFP 319
Cdd:PRK05341 241 EGPFELVAKFGGRLWRAEIDHSPLDVVAWHGNYAPYKYDLRRFNTIGSISFDHPDPSIFTVLTSPSDTPGTANIDFVIFP 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 320 PRWGVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDVDCFEKNSTALLKPERVaEGTMAFM 399
Cdd:PRK05341 321 PRWLVAENTFRPPWFHRNVMSEFMGLIHGVYDAKAEGFVPGGASLHNCMSPHGPDAETFEKASNADLKPHKI-DNTMAFM 399
                        410       420       430
                 ....*....|....*....|....*....|....*...
gi 148298760 400 FESSFSMAVTKWGLETCQRlDKNYYKCWEALKSHFNPN 437
Cdd:PRK05341 400 FETRYPIRPTRFALETPQL-QADYDDCWQGLKKHFDPE 436
PLN02658 PLN02658
homogentisate 1,2-dioxygenase
6-434 0e+00

homogentisate 1,2-dioxygenase


Pssm-ID: 215355  Cd Length: 435  Bit Score: 709.94  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760   6 YMSGFGNEFSSEdpRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWLYRILPSVRHKPFTRMS------CG 79
Cdd:PLN02658   1 YQSGFGNHFSSE--ALPGALPRGQNNPLLCPYGLYAEQLSGTAFTAPRKLNRRSWLYRIKPSVTHEPFKPRVpaheklVG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  80 DLTENWNeVEPDPNQLRWKPFNIPkssEKKVDFVSGLHTVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQ 159
Cdd:PLN02658  79 EFDPSNS-CETTPTQLRWRPFPVP---DSPVDFVDGLFTVCGAGSPFLRHGYAIHMYVANKSMDDCAFCNADGDFLIVPQ 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 160 QGEILITTEFGKMMVEPNEICVIQQGMRFSVDVF-GETRGYILEVFGAHFELPDLGPIGANGLANPRDFQTPVAWYEDRT 238
Cdd:PLN02658 155 QGRLWIKTELGKLQVSPGEIVVIPRGFRFAVDLPdGPSRGYVLEIFGGHFQLPDLGPIGANGLANPRDFLHPVAWFEDGS 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 239 IAtGYTIVNKYQGKLFSCQQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLTAKSTRPGVAIADFVIF 318
Cdd:PLN02658 235 RP-GYTIVQKFGGELFTAKQDFSPFNVVAWHGNYVPYKYDLSKFCPVNTVLFDHADPSINTVLTAPTDKPGVALADFVIF 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 319 PPRWGVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDVDCFEKN-STALLKPERVAEGTMA 397
Cdd:PLN02658 314 PPRWLVAEHTFRPPYYHRNCMSEFMGLIYGSYEAKADGFLPGGASLHSCMTPHGPDTATYEATiARPCADAPSKLTGTLA 393
                        410       420       430
                 ....*....|....*....|....*....|....*..
gi 148298760 398 FMFESSFSMAVTKWGLEtCQRLDKNYYKCWEALKSHF 434
Cdd:PLN02658 394 FMFESSLIPRVCPWALE-SPFRDRDYYQCWIGLKSHF 429
HmgA COG3508
Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport and catabolism];
4-436 0e+00

Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport and catabolism];


Pssm-ID: 226039  Cd Length: 427  Bit Score: 519.77  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760   4 LKYMSGFGNEFSSEDprCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWLYRILPSVRHKPFTRMSCGDLTE 83
Cdd:COG3508    3 ARYQSGFGNVFETEA--LPGALPVGQNSPQKAPYGLYAEQLSGSAFTAPRGENRRSWLYRIRPSANHPTFRPMKLGEWKS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760  84 NWNEVEPDPNQLRWKPFNIPKSSEkkvDFVSGLHTVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQQGEI 163
Cdd:COG3508   81 ALIGPWATPNQLRWSPLPLPKAPT---DFLDGILLIANNGDADTQDGVAIHVYKVNESMTKRFFRNADGELLIVPQQGEL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 164 LITTEFGKMMVEPNEICVIQQGMRFSVDVF-GETRGYILEVFGAHFELPDLGPIGANGLANPRDFQTPVAWYEDRTiaTG 242
Cdd:COG3508  158 RLKTELGVLEVEPGEIAVIPRGTTFRVELKdGEARGYGCENYGAKFRLPELGPIGANGLANPRDFKTPVARYEDSE--GP 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 243 YTIVNKYQGKLFSCQQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLTAKSTRPGVAIADFVIFPPRW 322
Cdd:COG3508  236 TQLVVKTHGGLWAVELDHSPLDVVAWHGNLAPYKYDLRDFNPIGTISYDHPDPSIFTVLTAPSDTPGFANCDFVIFPPRW 315
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148298760 323 GVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDVDCFEKNSTALLKPERVaEGTMAFMFES 402
Cdd:COG3508  316 LVAEQTFRPPWYHRNDMSEFMGLISGQYDAKAEGFVPGGASLHNCMSAHGPDPSAFEKALNARLKPHKI-DDTMAFMFET 394
                        410       420       430
                 ....*....|....*....|....*....|....
gi 148298760 403 SFSMAVTKWGLETCQRLDkNYYKCWEALkshFNP 436
Cdd:COG3508  395 RKVLRPSRYAAEIDALQD-DYDACWQGL---FNK 424
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH