NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148241111|ref|YP_001226268|]
View 

Serine phosphatase RsbU, regulator of sigma subunit [Synechococcus sp. RCC307]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
255-449 1.35e-63

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 205.99  E-value: 1.35e-63
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111  255 GRWALVMGDVMGKGIPAGLLMTLLRGMLRAEVLTGLPPDRILHDLNELAQEDLAQSnRFVTLFYSELDPVTRVLRFSNAA 334
Cdd:pfam07228   3 GRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGE-RFATAVLAVYDPETGTLEYANAG 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111  335 HNPPLIWRRQRHSVERLDAPGLLIGLQPDADYGCEQVQLEPGDVLLYYTDGVTEASGVGGERFDEERLMRALLAIckTVP 414
Cdd:pfam07228  82 HPPPLLLRPDGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAER--HGL 159
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 148241111  415 DAQGILDQLFARLDRFvgPGRQLEDDASMVVLKVR 449
Cdd:pfam07228 160 SPEELLDALLEDLLRL--GGGELEDDITLLVLRVR 192
GAF_3 pfam13492
GAF domain;
50-183 2.84e-05

GAF domain;


:

Pssm-ID: 257816  Cd Length: 129  Bit Score: 42.43  E-value: 2.84e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111   50 NLSRFLELVPLLTARLVEAEGAVLLTFRSDGGLWREQLHCSSQSRCGELLRQlaglqDSDLDRDAGDEAMATRLDQLVRR 129
Cdd:pfam13492   1 DPDELLERALELLAELLGADRAALYLLDEDGLELRLVAGSGGEPRLSESLPE-----DSPLAQRALEKGEPVSVPAGDNR 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 148241111  130 Q-LGDVQLFGTSVVAKNRQRGRLYVFSGDPQfSWSEVRRRHVQLVADQTAVAIEN 183
Cdd:pfam13492  76 DlLPSESLLAVPLRAGGEVIGVLVLESTPEE-AFTPEDLELLELLASQIAIALEN 129
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
148-449 9.65e-67

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


:

Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 219.97  E-value: 9.65e-67
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111 148 RGRLYVFSGDPQFSWSEVRRRHVQLVADQTAVAIENELLLEEMRRHERLDQQLSIGGEIQSQLLPSRCPVIEGVELAARC 227
Cdd:COG2208   76 SGKLRALSEEIKHWRGGLPLVAELLVEINRAVGLVSAHNELLLLEQNNISAELEVARQIQQNLLPKALPLFPGIDIEAIL 155
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111 228 RPAFQVGGDYFDFIPtrpqllgkrREQGRWALVMGDVMGKGIPAGLLMTLLRGMLRAEVLTGLP-PDRILHDLNELAQED 306
Cdd:COG2208  156 VPASEVGGDYYDFIQ---------LGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESGPLdPADVLETLNRVLKQN 226
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111 307 LaQSNRFVTLFYSELDPVTRVLRFSNAAHNPPLIWRRQ-RHSVERLDAPGLLIGLQPDADYGCEQVQLEPGDVLLYYTDG 385
Cdd:COG2208  227 L-EEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADgEIEVEDLTALGLPIGLLPDYQYEVASLQLEPGDLLVLYTDG 305
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148241111 386 VTEASGVGGERFDEERLMRALLAIckTVPDAQGILDQLFARLDRFVGpGRQLEDDASMVVLKVR 449
Cdd:COG2208  306 VTEARNSDGEFFGLERLLKILGRL--LGQPAEEILEAILESLEELQG-DQIQDDDITLLVLKVK 366
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
255-449 1.35e-63

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 205.99  E-value: 1.35e-63
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111  255 GRWALVMGDVMGKGIPAGLLMTLLRGMLRAEVLTGLPPDRILHDLNELAQEDLAQSnRFVTLFYSELDPVTRVLRFSNAA 334
Cdd:pfam07228   3 GRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGE-RFATAVLAVYDPETGTLEYANAG 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111  335 HNPPLIWRRQRHSVERLDAPGLLIGLQPDADYGCEQVQLEPGDVLLYYTDGVTEASGVGGERFDEERLMRALLAIckTVP 414
Cdd:pfam07228  82 HPPPLLLRPDGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAER--HGL 159
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 148241111  415 DAQGILDQLFARLDRFvgPGRQLEDDASMVVLKVR 449
Cdd:pfam07228 160 SPEELLDALLEDLLRL--GGGELEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
220-425 4.60e-43

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 151.35  E-value: 4.60e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111   220 GVELAARCRPAFQVGGDYFDFIPTRPqllgkrreqGRWALVMGDVMGKGIPAGLLMTLLRGMLRAEVLTGLPPDRILHDL 299
Cdd:smart00331   3 GGLIAQYYEDATQVGGDFYDVVKLPE---------GRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERL 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111   300 NELAQEDLAQSnRFVTLFYSELDPVTRVLRFSNAAHNPPLIWRRQRHSVERLDAPGLLIGLQPDADYGCEQVQLEPGDVL 379
Cdd:smart00331  74 NRAIYENGEDG-MFATLFLALYDFAGGTLSYANAGHSPPYLLRADGGLVEDLDDLGAPLGLEPDVEVDVRELTLEPGDLL 152
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*.
gi 148241111   380 LYYTDGVTEAsgVGGERFdeERLMRALLAICKTVPdAQGILDQLFA 425
Cdd:smart00331 153 LLYTDGLTEA--RNPERL--EELLEELLGSPPAEI-AQRILEELLE 193
GAF_3 pfam13492
GAF domain;
50-183 2.84e-05

GAF domain;


Pssm-ID: 257816  Cd Length: 129  Bit Score: 42.43  E-value: 2.84e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111   50 NLSRFLELVPLLTARLVEAEGAVLLTFRSDGGLWREQLHCSSQSRCGELLRQlaglqDSDLDRDAGDEAMATRLDQLVRR 129
Cdd:pfam13492   1 DPDELLERALELLAELLGADRAALYLLDEDGLELRLVAGSGGEPRLSESLPE-----DSPLAQRALEKGEPVSVPAGDNR 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 148241111  130 Q-LGDVQLFGTSVVAKNRQRGRLYVFSGDPQfSWSEVRRRHVQLVADQTAVAIEN 183
Cdd:pfam13492  76 DlLPSESLLAVPLRAGGEVIGVLVLESTPEE-AFTPEDLELLELLASQIAIALEN 129
FhlA COG2203
FOG: GAF domain [Signal transduction mechanisms]
138-194 6.15e-04

FOG: GAF domain [Signal transduction mechanisms]


Pssm-ID: 225113  Cd Length: 175  Bit Score: 39.19  E-value: 6.15e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 148241111 138 GTSVVAKNRQRGRLYVFSGDPQFSWSEVRRRHVQLVADQTAVAIENELLLEEMRRHE 194
Cdd:COG2203  119 GVPLIAQGELLGLLCVHDSEPRRQWSEEELELLEELAEQVAIAIERARLYEELQEAE 175
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
148-449 9.65e-67

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 219.97  E-value: 9.65e-67
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111 148 RGRLYVFSGDPQFSWSEVRRRHVQLVADQTAVAIENELLLEEMRRHERLDQQLSIGGEIQSQLLPSRCPVIEGVELAARC 227
Cdd:COG2208   76 SGKLRALSEEIKHWRGGLPLVAELLVEINRAVGLVSAHNELLLLEQNNISAELEVARQIQQNLLPKALPLFPGIDIEAIL 155
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111 228 RPAFQVGGDYFDFIPtrpqllgkrREQGRWALVMGDVMGKGIPAGLLMTLLRGMLRAEVLTGLP-PDRILHDLNELAQED 306
Cdd:COG2208  156 VPASEVGGDYYDFIQ---------LGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESGPLdPADVLETLNRVLKQN 226
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111 307 LaQSNRFVTLFYSELDPVTRVLRFSNAAHNPPLIWRRQ-RHSVERLDAPGLLIGLQPDADYGCEQVQLEPGDVLLYYTDG 385
Cdd:COG2208  227 L-EEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADgEIEVEDLTALGLPIGLLPDYQYEVASLQLEPGDLLVLYTDG 305
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148241111 386 VTEASGVGGERFDEERLMRALLAIckTVPDAQGILDQLFARLDRFVGpGRQLEDDASMVVLKVR 449
Cdd:COG2208  306 VTEARNSDGEFFGLERLLKILGRL--LGQPAEEILEAILESLEELQG-DQIQDDDITLLVLKVK 366
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
83-448 1.86e-05

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs [Cellular processes, Sporulation and germination].


Pssm-ID: 234038 [Multi-domain]  Cd Length: 764  Bit Score: 45.84  E-value: 1.86e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111   83 WREQLhCSSQSRCGEllrQLAGLQDSdLDRDAGDEAMATRLDQL----VRRQLGDVQLFGTSVVAKNRQRGRLYVfsgDP 158
Cdd:TIGR02865 427 WRKRL-EEGRRLVAE---QLKGVAES-VEDIAKEINLEIVFHQLleekIIRALNKNGIPYEDVLAYNTEGGNIDV---EL 498
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111  159 QFSWSEVRRRHVQLVAdqtavAIENELLLEEMrrhERLDQQLSIGGEIQSQLLPSRCPVIEGVELAAR-CRPAFQVGGDY 237
Cdd:TIGR02865 499 TIAACGGRGECEKKIA-----PIISEVTGELM---CVKDERCSIDPKGRCHLTFEETPKYHVSTGVARaAKDGELVSGDS 570
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111  238 FDFIPTRPqllgkrreqGRWALVMGDVMGKGIPA----GLLMTLLRGMLRAevltGLPPDRILHDLNEL-----AQEdla 308
Cdd:TIGR02865 571 YSFGKLSA---------GKYAVAISDGMGSGPEAaqesSACVRLLEKFLES----GFDREVAIKTVNSIlslrsTDE--- 634
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111  309 qsnRFVTLFYSELDPVTRVLRFSNAAHNPPLIwrRQRHSVERLDAPGLLIGLQPDADYGCEQVQLEPGDVLLYYTDGVte 388
Cdd:TIGR02865 635 ---KFSTLDLSVIDLYTGQAEFVKVGAVPSFI--KRGAKVEVIRSSNLPIGILDEVDVELVRKKLKNGDLIVMVSDGV-- 707
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 148241111  389 asgVGGERfDEERLMRALLAICK--TVPDAQGILDQLFARLDRfVGPGrQLEDDASMVVLKV 448
Cdd:TIGR02865 708 ---LEGEK-EVEGKVLWLVRKLKetNTNDPEEIAEYLLEKAKE-LRSG-KIKDDMTVIVAKV 763
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
255-449 1.35e-63

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 205.99  E-value: 1.35e-63
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111  255 GRWALVMGDVMGKGIPAGLLMTLLRGMLRAEVLTGLPPDRILHDLNELAQEDLAQSnRFVTLFYSELDPVTRVLRFSNAA 334
Cdd:pfam07228   3 GRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGE-RFATAVLAVYDPETGTLEYANAG 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111  335 HNPPLIWRRQRHSVERLDAPGLLIGLQPDADYGCEQVQLEPGDVLLYYTDGVTEASGVGGERFDEERLMRALLAIckTVP 414
Cdd:pfam07228  82 HPPPLLLRPDGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAER--HGL 159
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 148241111  415 DAQGILDQLFARLDRFvgPGRQLEDDASMVVLKVR 449
Cdd:pfam07228 160 SPEELLDALLEDLLRL--GGGELEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
220-425 4.60e-43

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 151.35  E-value: 4.60e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111   220 GVELAARCRPAFQVGGDYFDFIPTRPqllgkrreqGRWALVMGDVMGKGIPAGLLMTLLRGMLRAEVLTGLPPDRILHDL 299
Cdd:smart00331   3 GGLIAQYYEDATQVGGDFYDVVKLPE---------GRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERL 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111   300 NELAQEDLAQSnRFVTLFYSELDPVTRVLRFSNAAHNPPLIWRRQRHSVERLDAPGLLIGLQPDADYGCEQVQLEPGDVL 379
Cdd:smart00331  74 NRAIYENGEDG-MFATLFLALYDFAGGTLSYANAGHSPPYLLRADGGLVEDLDDLGAPLGLEPDVEVDVRELTLEPGDLL 152
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*.
gi 148241111   380 LYYTDGVTEAsgVGGERFdeERLMRALLAICKTVPdAQGILDQLFA 425
Cdd:smart00331 153 LLYTDGLTEA--RNPERL--EELLEELLGSPPAEI-AQRILEELLE 193
GAF_3 pfam13492
GAF domain;
50-183 2.84e-05

GAF domain;


Pssm-ID: 257816  Cd Length: 129  Bit Score: 42.43  E-value: 2.84e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111   50 NLSRFLELVPLLTARLVEAEGAVLLTFRSDGGLWREQLHCSSQSRCGELLRQlaglqDSDLDRDAGDEAMATRLDQLVRR 129
Cdd:pfam13492   1 DPDELLERALELLAELLGADRAALYLLDEDGLELRLVAGSGGEPRLSESLPE-----DSPLAQRALEKGEPVSVPAGDNR 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 148241111  130 Q-LGDVQLFGTSVVAKNRQRGRLYVFSGDPQfSWSEVRRRHVQLVADQTAVAIEN 183
Cdd:pfam13492  76 DlLPSESLLAVPLRAGGEVIGVLVLESTPEE-AFTPEDLELLELLASQIAIALEN 129
FhlA COG2203
FOG: GAF domain [Signal transduction mechanisms]
138-194 6.15e-04

FOG: GAF domain [Signal transduction mechanisms]


Pssm-ID: 225113  Cd Length: 175  Bit Score: 39.19  E-value: 6.15e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 148241111 138 GTSVVAKNRQRGRLYVFSGDPQFSWSEVRRRHVQLVADQTAVAIENELLLEEMRRHE 194
Cdd:COG2203  119 GVPLIAQGELLGLLCVHDSEPRRQWSEEELELLEELAEQVAIAIERARLYEELQEAE 175
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
148-449 9.65e-67

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 219.97  E-value: 9.65e-67
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111 148 RGRLYVFSGDPQFSWSEVRRRHVQLVADQTAVAIENELLLEEMRRHERLDQQLSIGGEIQSQLLPSRCPVIEGVELAARC 227
Cdd:COG2208   76 SGKLRALSEEIKHWRGGLPLVAELLVEINRAVGLVSAHNELLLLEQNNISAELEVARQIQQNLLPKALPLFPGIDIEAIL 155
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111 228 RPAFQVGGDYFDFIPtrpqllgkrREQGRWALVMGDVMGKGIPAGLLMTLLRGMLRAEVLTGLP-PDRILHDLNELAQED 306
Cdd:COG2208  156 VPASEVGGDYYDFIQ---------LGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESGPLdPADVLETLNRVLKQN 226
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111 307 LaQSNRFVTLFYSELDPVTRVLRFSNAAHNPPLIWRRQ-RHSVERLDAPGLLIGLQPDADYGCEQVQLEPGDVLLYYTDG 385
Cdd:COG2208  227 L-EEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADgEIEVEDLTALGLPIGLLPDYQYEVASLQLEPGDLLVLYTDG 305
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148241111 386 VTEASGVGGERFDEERLMRALLAIckTVPDAQGILDQLFARLDRFVGpGRQLEDDASMVVLKVR 449
Cdd:COG2208  306 VTEARNSDGEFFGLERLLKILGRL--LGQPAEEILEAILESLEELQG-DQIQDDDITLLVLKVK 366
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
83-448 1.86e-05

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs [Cellular processes, Sporulation and germination].


Pssm-ID: 234038 [Multi-domain]  Cd Length: 764  Bit Score: 45.84  E-value: 1.86e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111   83 WREQLhCSSQSRCGEllrQLAGLQDSdLDRDAGDEAMATRLDQL----VRRQLGDVQLFGTSVVAKNRQRGRLYVfsgDP 158
Cdd:TIGR02865 427 WRKRL-EEGRRLVAE---QLKGVAES-VEDIAKEINLEIVFHQLleekIIRALNKNGIPYEDVLAYNTEGGNIDV---EL 498
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111  159 QFSWSEVRRRHVQLVAdqtavAIENELLLEEMrrhERLDQQLSIGGEIQSQLLPSRCPVIEGVELAAR-CRPAFQVGGDY 237
Cdd:TIGR02865 499 TIAACGGRGECEKKIA-----PIISEVTGELM---CVKDERCSIDPKGRCHLTFEETPKYHVSTGVARaAKDGELVSGDS 570
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111  238 FDFIPTRPqllgkrreqGRWALVMGDVMGKGIPA----GLLMTLLRGMLRAevltGLPPDRILHDLNEL-----AQEdla 308
Cdd:TIGR02865 571 YSFGKLSA---------GKYAVAISDGMGSGPEAaqesSACVRLLEKFLES----GFDREVAIKTVNSIlslrsTDE--- 634
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148241111  309 qsnRFVTLFYSELDPVTRVLRFSNAAHNPPLIwrRQRHSVERLDAPGLLIGLQPDADYGCEQVQLEPGDVLLYYTDGVte 388
Cdd:TIGR02865 635 ---KFSTLDLSVIDLYTGQAEFVKVGAVPSFI--KRGAKVEVIRSSNLPIGILDEVDVELVRKKLKNGDLIVMVSDGV-- 707
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 148241111  389 asgVGGERfDEERLMRALLAICK--TVPDAQGILDQLFARLDRfVGPGrQLEDDASMVVLKV 448
Cdd:TIGR02865 708 ---LEGEK-EVEGKVLWLVRKLKetNTNDPEEIAEYLLEKAKE-LRSG-KIKDDMTVIVAKV 763
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH