NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148234891|ref|NP_001086448|]
View 

solute carrier family 12 member 8 [Xenopus laevis]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
2a30 TIGR00930
K-Cl cotransporter; [Transport and binding proteins, Other].
6-417 1.11e-82

K-Cl cotransporter; [Transport and binding proteins, Other].


:

Pssm-ID: 233194 [Multi-domain]  Cd Length: 953  Bit Score: 283.53  E-value: 1.11e-82
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891    6 PNRSVLLNGSMNGSENIKD----LFHEDAQVSQLQSRPwwkiqlfvwEPVLFGTWDGVFTSCMINIFGVVLFLRTGWLVG 81
Cdd:TIGR00930  36 DKVVSLLGPLADYTNNGQGmkehEEAEDAEGTKEKPPA---------GAVKFGWVMGVLVPCLLNIWGVILFLRLSWIVG 106
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891   82 NTGVLLGIVLVSFVILVALVTVLSGIGVCERCSIGSGGVYSMVSTVLGGKVGGTIGVLYIFGQCVAGAMYITGFAESISD 161
Cdd:TIGR00930 107 QAGIGLSLLIILLCCCVTTITGLSMSAIATNGVVKGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVLD 186
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  162 LL----------NLENMwvvRGISLAVLVGLLGINLAGVKWIIRLQLLLFLLLAVSTLDFVIGSF--THLDPENGFVGYS 229
Cdd:TIGR00930 187 LLrengskimvdPINDI---RIYGTVTVVVLLGISFAGMEWENKAQVLFLVIVLLSILNIFVGTIipAFDKPAKGFFGLG 263
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  230 EELLRNNTFPDYTPGES-FFTVFGVFFPAATGVMVGFNMSGDLQRPSINIPLGSLAAIGTSWFLYVVFVFLLGAICTREF 308
Cdd:TIGR00930 264 NEIFSENFIPGIPGPEGgFFSLFGIFFPSVTGILAGANISGDLKDPQKAIPKGTLLAILTTTVVYLGSVVLFGACVVRDA 343
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  309 LR-------------------------YEFM----IAEKVSLVGGLFLLGLYISSLASCMGGLYGAPRILQCIAQEKVIP 359
Cdd:TIGR00930 344 TGdkndtlvtnctsaacfsecahntcsYGLMnnlqVMSLVSPFPPLITAGIFSATLSSALASLVSAPRLFQALCKDNIYP 423
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 148234891  360 ALSFLGRGKGPNKTPVAAIFITGLLTMAFVFIGQVNVLAPIVTINFMLTYSAVDYSYF 417
Cdd:TIGR00930 424 FLQFFGKGYGKNGEPLRAYLLTAFIAEGFILIAELNTIAPIISNFFLASYALINFSCF 481
 
Name Accession Description Interval E-value
2a30 TIGR00930
K-Cl cotransporter; [Transport and binding proteins, Other].
6-417 1.11e-82

K-Cl cotransporter; [Transport and binding proteins, Other].


Pssm-ID: 233194 [Multi-domain]  Cd Length: 953  Bit Score: 283.53  E-value: 1.11e-82
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891    6 PNRSVLLNGSMNGSENIKD----LFHEDAQVSQLQSRPwwkiqlfvwEPVLFGTWDGVFTSCMINIFGVVLFLRTGWLVG 81
Cdd:TIGR00930  36 DKVVSLLGPLADYTNNGQGmkehEEAEDAEGTKEKPPA---------GAVKFGWVMGVLVPCLLNIWGVILFLRLSWIVG 106
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891   82 NTGVLLGIVLVSFVILVALVTVLSGIGVCERCSIGSGGVYSMVSTVLGGKVGGTIGVLYIFGQCVAGAMYITGFAESISD 161
Cdd:TIGR00930 107 QAGIGLSLLIILLCCCVTTITGLSMSAIATNGVVKGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVLD 186
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  162 LL----------NLENMwvvRGISLAVLVGLLGINLAGVKWIIRLQLLLFLLLAVSTLDFVIGSF--THLDPENGFVGYS 229
Cdd:TIGR00930 187 LLrengskimvdPINDI---RIYGTVTVVVLLGISFAGMEWENKAQVLFLVIVLLSILNIFVGTIipAFDKPAKGFFGLG 263
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  230 EELLRNNTFPDYTPGES-FFTVFGVFFPAATGVMVGFNMSGDLQRPSINIPLGSLAAIGTSWFLYVVFVFLLGAICTREF 308
Cdd:TIGR00930 264 NEIFSENFIPGIPGPEGgFFSLFGIFFPSVTGILAGANISGDLKDPQKAIPKGTLLAILTTTVVYLGSVVLFGACVVRDA 343
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  309 LR-------------------------YEFM----IAEKVSLVGGLFLLGLYISSLASCMGGLYGAPRILQCIAQEKVIP 359
Cdd:TIGR00930 344 TGdkndtlvtnctsaacfsecahntcsYGLMnnlqVMSLVSPFPPLITAGIFSATLSSALASLVSAPRLFQALCKDNIYP 423
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 148234891  360 ALSFLGRGKGPNKTPVAAIFITGLLTMAFVFIGQVNVLAPIVTINFMLTYSAVDYSYF 417
Cdd:TIGR00930 424 FLQFFGKGYGKNGEPLRAYLLTAFIAEGFILIAELNTIAPIISNFFLASYALINFSCF 481
AA_permease pfam00324
Amino acid permease;
58-412 3.93e-31

Amino acid permease;


Pssm-ID: 249769 [Multi-domain]  Cd Length: 472  Bit Score: 126.30  E-value: 3.93e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891   58 GVFTSCMINIFGVVLFLRTGWLVGNTGVLLGIVLVSFVILValvTVLSGIGVCERCSIG--SGGVYSMVSTVLGGKVGGT 135
Cdd:pfam00324   1 HVLMIALGGVIGTGLFVGSGSVLGQAGPAGALLGYLISGVV---IFLVMLSLGEMSTNGpvAGGFYAYASRFLGPSLGFA 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  136 IGVLYIFGQC------VAGAMYITGFAESISDLLNLEnmwvvrGISLAVLVGLLGINLAGVKWIIRLQLLLFLLLAVSTL 209
Cdd:pfam00324  78 TGWNYWLSWItvlaleLTAASILIQFWELVPDIPYTW------GWGAVFIVLLLIINLVGVKGYGEAEFWFALIKVIAII 151
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  210 DFVIGSFTHL---DPENGFVGYSEELLRNNTFPDYTPGES----FFTVFGVFFPAATGVMVGFNMSGDLQRPSINIPLGS 282
Cdd:pfam00324 152 AFIIVGVIILlsgGGPNDGAYLGDNGGKNNFPPGFAPGGGsfanFISVFVIAFFAFTGIELVGIAAGEVKNPEKSIPKAI 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  283 LAAIGTSWFLYVVFVFLLGAICTR------------EFLRYEFMIAEKVSLVGGLFLLGLYISSLASCMGGLYGAPRILQ 350
Cdd:pfam00324 232 LQVVWRITIFYILSLLAIGLLVPWndpglladsasaASPFVIFFKSLGISGLAPLINAVILTAALSAANSSLYSGSRMLY 311
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 148234891  351 CIAQEKVIPalsFLGRGKGPNKTPVAAIfitgLLTMAFVFIGQV-NVLAPIVTINFMLTYSAV 412
Cdd:pfam00324 312 ALARDGLAP---KFLKKVDKSGVPLRAI----LLSTAISLLAVLlASLNPAIVFNFLLAISGL 367
PotE COG0531
Amino acid transporters [Amino acid transport and metabolism]
58-417 9.01e-21

Amino acid transporters [Amino acid transport and metabolism]


Pssm-ID: 223605 [Multi-domain]  Cd Length: 466  Bit Score: 94.85  E-value: 9.01e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  58 GVFTSCMINIFGVVLFlrTGWLVGNTGVLLGIVLVSFVILVALVTVLSGIGVCERCSI---GSGGVYSMVSTVLGGKVGG 134
Cdd:COG0531   15 GLFDLLTALGVGSMIG--SGIFALPGSAAGLAPAAILAWLIAGIIILFLALSYAELSSaipSAGGAYAYAKRALGPRLGF 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891 135 TIGVLYIFGQCVAGAMYITGFAESISDLLNL-----ENMWVVRGISLAVLVGLLGINLAGVKWIIRLQLLLFLLLAVSTL 209
Cdd:COG0531   93 LAGWLYLLAYVIALAAIAIGAASYLSYLFPGpgllsIGPLLIILIALALIALLTLLNLRGIKASAKINSIITILKIIILL 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891 210 DFVIGSFTHLDPENGfvgyseellrnNTFPDYTPGESFFTVFGVFFPAATGVMVGF----NMSGDLQRPSINIPLGSLAA 285
Cdd:COG0531  173 IFIILGLFAFGFSNG-----------NLFAPFNPGGGSFGGILAAILLAFFAFTGFeaiaTLAEEVKNPKRTIPRAIILS 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891 286 IGTSWFLYVVFVFLLGAICTRE------FLRYEFMIAEKVSLVGGLF--LLGLYISSLASCMGGLYGAPRILQCIAQEKV 357
Cdd:COG0531  242 LLIVLILYILGALVIVGVLPAGdlaasaPSAPLALAALFGGGNWGAIiiAILALLSLFGSLLAWILAVSRVLYAMARDGL 321
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 148234891 358 IPalSFLGRGKGPNKTPVAAIFITGLLTMAFVFIG-----QVNVLAPIVTINFMLTYSAVDYSYF 417
Cdd:COG0531  322 LP--KFFAKVNPKGRTPVIALILTGIISLILLLLFplssiAFNALVSLASVAFLIAYLLVALALL 384
 
Name Accession Description Interval E-value
2a30 TIGR00930
K-Cl cotransporter; [Transport and binding proteins, Other].
6-417 1.11e-82

K-Cl cotransporter; [Transport and binding proteins, Other].


Pssm-ID: 233194 [Multi-domain]  Cd Length: 953  Bit Score: 283.53  E-value: 1.11e-82
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891    6 PNRSVLLNGSMNGSENIKD----LFHEDAQVSQLQSRPwwkiqlfvwEPVLFGTWDGVFTSCMINIFGVVLFLRTGWLVG 81
Cdd:TIGR00930  36 DKVVSLLGPLADYTNNGQGmkehEEAEDAEGTKEKPPA---------GAVKFGWVMGVLVPCLLNIWGVILFLRLSWIVG 106
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891   82 NTGVLLGIVLVSFVILVALVTVLSGIGVCERCSIGSGGVYSMVSTVLGGKVGGTIGVLYIFGQCVAGAMYITGFAESISD 161
Cdd:TIGR00930 107 QAGIGLSLLIILLCCCVTTITGLSMSAIATNGVVKGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVLD 186
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  162 LL----------NLENMwvvRGISLAVLVGLLGINLAGVKWIIRLQLLLFLLLAVSTLDFVIGSF--THLDPENGFVGYS 229
Cdd:TIGR00930 187 LLrengskimvdPINDI---RIYGTVTVVVLLGISFAGMEWENKAQVLFLVIVLLSILNIFVGTIipAFDKPAKGFFGLG 263
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  230 EELLRNNTFPDYTPGES-FFTVFGVFFPAATGVMVGFNMSGDLQRPSINIPLGSLAAIGTSWFLYVVFVFLLGAICTREF 308
Cdd:TIGR00930 264 NEIFSENFIPGIPGPEGgFFSLFGIFFPSVTGILAGANISGDLKDPQKAIPKGTLLAILTTTVVYLGSVVLFGACVVRDA 343
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  309 LR-------------------------YEFM----IAEKVSLVGGLFLLGLYISSLASCMGGLYGAPRILQCIAQEKVIP 359
Cdd:TIGR00930 344 TGdkndtlvtnctsaacfsecahntcsYGLMnnlqVMSLVSPFPPLITAGIFSATLSSALASLVSAPRLFQALCKDNIYP 423
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 148234891  360 ALSFLGRGKGPNKTPVAAIFITGLLTMAFVFIGQVNVLAPIVTINFMLTYSAVDYSYF 417
Cdd:TIGR00930 424 FLQFFGKGYGKNGEPLRAYLLTAFIAEGFILIAELNTIAPIISNFFLASYALINFSCF 481
AA_permease pfam00324
Amino acid permease;
58-412 3.93e-31

Amino acid permease;


Pssm-ID: 249769 [Multi-domain]  Cd Length: 472  Bit Score: 126.30  E-value: 3.93e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891   58 GVFTSCMINIFGVVLFLRTGWLVGNTGVLLGIVLVSFVILValvTVLSGIGVCERCSIG--SGGVYSMVSTVLGGKVGGT 135
Cdd:pfam00324   1 HVLMIALGGVIGTGLFVGSGSVLGQAGPAGALLGYLISGVV---IFLVMLSLGEMSTNGpvAGGFYAYASRFLGPSLGFA 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  136 IGVLYIFGQC------VAGAMYITGFAESISDLLNLEnmwvvrGISLAVLVGLLGINLAGVKWIIRLQLLLFLLLAVSTL 209
Cdd:pfam00324  78 TGWNYWLSWItvlaleLTAASILIQFWELVPDIPYTW------GWGAVFIVLLLIINLVGVKGYGEAEFWFALIKVIAII 151
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  210 DFVIGSFTHL---DPENGFVGYSEELLRNNTFPDYTPGES----FFTVFGVFFPAATGVMVGFNMSGDLQRPSINIPLGS 282
Cdd:pfam00324 152 AFIIVGVIILlsgGGPNDGAYLGDNGGKNNFPPGFAPGGGsfanFISVFVIAFFAFTGIELVGIAAGEVKNPEKSIPKAI 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  283 LAAIGTSWFLYVVFVFLLGAICTR------------EFLRYEFMIAEKVSLVGGLFLLGLYISSLASCMGGLYGAPRILQ 350
Cdd:pfam00324 232 LQVVWRITIFYILSLLAIGLLVPWndpglladsasaASPFVIFFKSLGISGLAPLINAVILTAALSAANSSLYSGSRMLY 311
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 148234891  351 CIAQEKVIPalsFLGRGKGPNKTPVAAIfitgLLTMAFVFIGQV-NVLAPIVTINFMLTYSAV 412
Cdd:pfam00324 312 ALARDGLAP---KFLKKVDKSGVPLRAI----LLSTAISLLAVLlASLNPAIVFNFLLAISGL 367
PotE COG0531
Amino acid transporters [Amino acid transport and metabolism]
58-417 9.01e-21

Amino acid transporters [Amino acid transport and metabolism]


Pssm-ID: 223605 [Multi-domain]  Cd Length: 466  Bit Score: 94.85  E-value: 9.01e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  58 GVFTSCMINIFGVVLFlrTGWLVGNTGVLLGIVLVSFVILVALVTVLSGIGVCERCSI---GSGGVYSMVSTVLGGKVGG 134
Cdd:COG0531   15 GLFDLLTALGVGSMIG--SGIFALPGSAAGLAPAAILAWLIAGIIILFLALSYAELSSaipSAGGAYAYAKRALGPRLGF 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891 135 TIGVLYIFGQCVAGAMYITGFAESISDLLNL-----ENMWVVRGISLAVLVGLLGINLAGVKWIIRLQLLLFLLLAVSTL 209
Cdd:COG0531   93 LAGWLYLLAYVIALAAIAIGAASYLSYLFPGpgllsIGPLLIILIALALIALLTLLNLRGIKASAKINSIITILKIIILL 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891 210 DFVIGSFTHLDPENGfvgyseellrnNTFPDYTPGESFFTVFGVFFPAATGVMVGF----NMSGDLQRPSINIPLGSLAA 285
Cdd:COG0531  173 IFIILGLFAFGFSNG-----------NLFAPFNPGGGSFGGILAAILLAFFAFTGFeaiaTLAEEVKNPKRTIPRAIILS 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891 286 IGTSWFLYVVFVFLLGAICTRE------FLRYEFMIAEKVSLVGGLF--LLGLYISSLASCMGGLYGAPRILQCIAQEKV 357
Cdd:COG0531  242 LLIVLILYILGALVIVGVLPAGdlaasaPSAPLALAALFGGGNWGAIiiAILALLSLFGSLLAWILAVSRVLYAMARDGL 321
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 148234891 358 IPalSFLGRGKGPNKTPVAAIFITGLLTMAFVFIG-----QVNVLAPIVTINFMLTYSAVDYSYF 417
Cdd:COG0531  322 LP--KFFAKVNPKGRTPVIALILTGIISLILLLLFplssiAFNALVSLASVAFLIAYLLVALALL 384
AA_permease_2 pfam13520
Amino acid permease;
53-412 9.89e-14

Amino acid permease;


Pssm-ID: 257840 [Multi-domain]  Cd Length: 425  Bit Score: 72.35  E-value: 9.89e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891   53 FGTWDgVFTSCMINIFGVVLFLRTGWLVGNTGVLLGIVLVSFVILVALVTVLSGIGvceRCSIGSGGVYSMVSTVLGGKV 132
Cdd:pfam13520   1 LSLLS-AFALVIGSIIGSGIFVTPLIASAGAAAILWGWIAALIFSLAVALVYAELS---SAFPRNGGIYVWLKNAFGKPV 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  133 GGTIGVLYIFGQCVAGAMYITGFAESISDLLNL---ENMWVVRGISLAVLVGLLGINLAGVKWIIRLQLLLFLLLAVSTL 209
Cdd:pfam13520  77 AFIAAWFNWLAYILGLASSSSVAASYLLSAFGPdlvGNTWLTYGIAIAILIIFALINIRGIKESAKIQNILGIVKLLLPL 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  210 DFVIGSFTHLDPENGFvgYSEELLRNNTFPDYTPGesFFTVFGVFFPAATGVMVGFNMSGDLQRPsiNIPLGSLAAIGTS 289
Cdd:pfam13520 157 ILIILLGLVLASGGGF--NLLPNSWTTFFPSGWPG--VFLGLLVVLWSFGGFESAANVSEEVKKR--DVPKALFIGLLIV 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  290 WFLYVVFVFLLGAICTREFL----RYEFMIA---EKV--SLVGGLFLLGLYISSLASCMGGLYGAPRILQCIAQEKVIPa 360
Cdd:pfam13520 231 GVLYLLVNILFLGVVPDDEIaklnNLPSVAAllfEAVggPWGAIIVAILLALSLLGAVNTAIVASSRVLEALARDGVLP- 309
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|..
gi 148234891  361 lSFLGRgKGPNKTPVAAIFITGLLTMAFVFIgqvnVLAPIVTINFMLTYSAV 412
Cdd:pfam13520 310 -KFFAK-VNKFGSPVRAIILTAILSLILLLL----FLLGGAAYNALLSLSAV 355
SdaC COG0814
Amino acid permeases [Amino acid transport and metabolism]
60-299 7.33e-04

Amino acid permeases [Amino acid transport and metabolism]


Pssm-ID: 223884 [Multi-domain]  Cd Length: 415  Bit Score: 41.10  E-value: 7.33e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  60 FTSCMINIFGV-----VLFLRTgwLVGNTGVLLGIVLVsfvILVALVTVLSGIGVCE---RCSIGSGGVYSMVSTVLGGK 131
Cdd:COG0814   11 DLGGVLILAGTaigagVLFLPV--AFGGGGFWPGLLLL---IIAWPLTYLSLLLLLEallSSPNGKASITSLVEDYLGKK 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891 132 VGGTIGVLYIFGQCVAGAMYITGFAESISDLLN---LENMWVVRGISLAVLVGLLGINLAGVKWIIRLQLLLFLLLAVST 208
Cdd:COG0814   86 GGILIGLSYFFALYGLLVAYIVGIGNLLASFLGnqfGLNPLPRKLGSLIFALVLAFLSWLGTLAVLKITSLLVFGKVIYL 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891 209 LDFVIGSFTHLDPENGFVGYSEELLRNNTfpdytpgesFFTVFGVFFPAATGVMVGFNMSGDLQRPSI-NIPLGSLAAIG 287
Cdd:COG0814  166 VLLVVYLIPHWNPANLFALPSASQSFWKY---------LLLAIPVFVFSFGFHGNIPSLVNYMRKNSKkAVRKAILIGSL 236
                        250
                 ....*....|..
gi 148234891 288 TSWFLYVVFVFL 299
Cdd:COG0814  237 IALVLYILVGFF 248
2A0303 TIGR00906
cationic amino acid transport permease; [Transport and binding proteins, Amino acids, peptides ...
241-412 1.69e-03

cationic amino acid transport permease; [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 129984 [Multi-domain]  Cd Length: 557  Bit Score: 40.18  E-value: 1.69e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  241 YTPGESFFTVFG---VFFPAATG--VMVGFN----MSGDLQRPSINIPLGslaaIGTSWFLYVVFVFLLGAICTreFLRY 311
Cdd:TIGR00906 218 EEKGAGGFMPYGftgVLSGAATCffAFIGFDaiatTGEEVKNPQRAIPIG----IVTSLLVCFVAYFLMSAALT--LMMP 291
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  312 EFMIAEK----VSLVGGLFLLGLYISS-------LASCMGGLYGAPRILQCIAQEKVIPalSFLGRGKGPNKTPVAAIFI 380
Cdd:TIGR00906 292 YYLLDPDapfpVAFEYVGWGPAKYIVAvgalcgmSTSLLGGMFPLPRVIYAMARDGLLF--KWLAQINSKTKTPINATVV 369
                         170       180       190
                  ....*....|....*....|....*....|....
gi 148234891  381 TGLLT--MAFVFigQVNVLAPIVTINFMLTYSAV 412
Cdd:TIGR00906 370 SGAIAalMAFLF--DLKALVDLLSIGTLLAYSLV 401
2A0306 TIGR00909
amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines].
58-412 6.42e-03

amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 129987 [Multi-domain]  Cd Length: 429  Bit Score: 38.19  E-value: 6.42e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891   58 GVFTSCMINIFGVV---LFLRTGWLVGNTGvllGIVLVSFVIlVALVTVLSGIGVCERCSI--GSGGVYSMVSTVLGGKV 132
Cdd:TIGR00909   6 GLFDLTMLGIGAMIgtgIFVVTGIAAGKAG---PAVILSFVL-AGLTALFIALVYAELAAMlpVAGSPYTYAYEAMGELT 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  133 GGTIGVLYIFGQCVAGAMYITGFAESISDLLN-------------LENMWVVRGISLAVLVGLLGINLAGVKWIIRLQLL 199
Cdd:TIGR00909  82 AFIIGWSLWLEYGVAVAAVAVGWGGYLQEFLPgvgldlpavltakPGNGGVFNLPALLIVLFLTYILYLGAKESGKVNDI 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  200 LFLLLAVSTLDFVIGSFTHLDPENgfvgyseellrnntfpdYTPGESF-----FTVFGVFFPAATGVMVGFNMSGDLQRP 274
Cdd:TIGR00909 162 LVVLKVAALLLFAALGAIHFASNN-----------------YTPFMPMgfggvGAATALVFFAFIGFEAISTAAEEVKNP 224
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  275 SINIPLGSLAAIGTSWFLYVVFVF-LLGAICTREFLR-----YEFMIAEKVSLVGGLFLLGLYISSLASCMGGLYGAPRI 348
Cdd:TIGR00909 225 ERDIPKAIILSLIVVTLLYVLVAAvILGAVPWRQLAGstaplSLVGYDLGQGIGGLILTAGAVFSIASVMLAGIYGTSRV 304
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148234891  349 LQCIAQEKVIPalSFLGRGKGPNKTPVAAIFITGLLTMAFVFIGQVNVLAPIVTINFMLTYSAV 412
Cdd:TIGR00909 305 LFAMSRDGLLP--GSLSKVHPKTGTPHMSIIIFSLTAALLASLVPLEGLAELTSIGTLIAFAAV 366
2A0308 TIGR00911
L-type amino acid transporter; [Transport and binding proteins, Amino acids, peptides and ...
169-392 7.18e-03

L-type amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 233179 [Multi-domain]  Cd Length: 501  Bit Score: 38.19  E-value: 7.18e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  169 WVVRGISLAVLVGLLGINLAGVKWIIRLQLLLFLLLAVSTLDFVI--------GSFTHLDPENGFVGYseellrnntfpD 240
Cdd:TIGR00911 163 WAIRLVAVLCVLLLTLVNCLSVKWATRVQDIFTACKLLALLLIIItgwvqlgkGGVESLNPKNAFEGT-----------E 231
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148234891  241 YTPGESFFTVFGVFFPAATGVMVGFnMSGDLQRPSINIPLGSLAAIGTSWFLYV-VFVFLLGAICTREFLRYEFMIAEKV 319
Cdd:TIGR00911 232 TSAGGIVLAFYSGIWAYGGWNYLNF-VTEEVKNPYRTLPIAIIISMPIVTFIYVlTNIAYFTVLSPEELLASLAVAVDFG 310
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 148234891  320 SLVGGLFLLGLYISSLASCMGG----LYGAPRILQCIAQEKVIPALSFLGRGKgpNKTPVAAIFITGLLTMAFVFIG 392
Cdd:TIGR00911 311 ERLLGVMSWAMPALVGLSCFGSvngsLFSSSRLFFVGGREGHLPSLLSMIHVK--RLTPLPSLLIVCTLTLLMLFSG 385
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH