NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148233624|ref|NP_001079655|]
View 

uncharacterized protein LOC379342 [Xenopus laevis]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Aa_trans super family cl17468
Transmembrane amino acid transporter protein; This transmembrane region is found in many amino ...
69-378 1.11e-06

Transmembrane amino acid transporter protein; This transmembrane region is found in many amino acid transporters including UNC-47 and MTR. UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT). UNC-47 is predicted to have 10 transmembrane domains. MTR is a N system amino acid transporter system protein involved in methyltryptophan resistance. Other members of this family include proline transporters and amino acid permeases.


The actual alignment was detected with superfamily member TIGR00907:

Pssm-ID: 266708  Cd Length: 482  Bit Score: 49.74  E-value: 1.11e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   69 AGSVGMALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGG--------LAGFLRLWIAVLVIYPTN------ 134
Cdd:TIGR00907  43 SGGAMSIVWGWIIAGAGSICIALSLAELSSAYPTSGGQYFWSAKLAPPrqmpfaswMTGWFNLAGQVAGTASTDlsvaql 122
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  135 -QAVIALT--FSNYVLQPLFptcfapesgLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAGKLLALGLIIIMGIVQICk 211
Cdd:TIGR00907 123 iLGIVSLTtpGREYIPTRWH---------IFGIMIGIHLIHALINSLPTKWLPRITSSAAYWSLLGFLTICITLLACKS- 192
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  212 GEYFwlEPKNAFENFQEPDIGL--IALAFLQGsFAYGGWNFLNY-----VTEELVNPYKNLPRAIfisIPLVTFVYVFA- 283
Cdd:TIGR00907 193 PKFN--DGKFVFTNFNNSTGGWkpGGFAFLLG-LLNPAWSMTGYdgtahMAEEIENPEVVGPRAI---IGAVAIGIVTGf 266
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  284 --NIAYVTAMSPQELLASNAVAVTFGEKLLGVM-----AWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLP--SLM 354
Cdd:TIGR00907 267 cfNIVLFFSMGDIDSLISSTTGQPIAQIFYNALgnkagAIFLLCLILVTSFFCAITCMTANSRMIYAFSRDGGLPfsPLW 346
                         330       340
                  ....*....|....*....|....
gi 148233624  355 AMIHIKRCTPIPALLFTCISTLLM 378
Cdd:TIGR00907 347 SRVNPRTQVPLNAVWLSAVWIILI 370
2A0308 TIGR00911
L-type amino acid transporter; [Transport and binding proteins, Amino acids, peptides and ...
34-497 0e+00

L-type amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines].


:

Pssm-ID: 233179 [Multi-domain]  Cd Length: 501  Bit Score: 703.81  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   34 VALKKEIGLVSACGIIVGNIIGSGIFVSPKGVMENAGSVGMALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDI 113
Cdd:TIGR00911  38 VALKKEITLLSGVGIIVGTIIGSGIFVSPKGVLKNAGSVGLALIMWAVCGIFSIVGALVYAELGTTIPKSGGEYNYILEV 117
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  114 FGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFAPESGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAG 193
Cdd:TIGR00911 118 FGPLLAFLRLWIELLVIRPGSQAVNALNFAIYILTPVFPDCEVPEWAIRLVAVLCVLLLTLVNCLSVKWATRVQDIFTAC 197
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  194 KLLALGLIIIMGIVQICKGEYFWLEPKNAFENFqEPDIGLIALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFISI 273
Cdd:TIGR00911 198 KLLALLLIIITGWVQLGKGGVESLNPKNAFEGT-ETSAGGIVLAFYSGIWAYGGWNYLNFVTEEVKNPYRTLPIAIIISM 276
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  274 PLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSL 353
Cdd:TIGR00911 277 PIVTFIYVLTNIAYFTVLSPEELLASLAVAVDFGERLLGVMSWAMPALVGLSCFGSVNGSLFSSSRLFFVGGREGHLPSL 356
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  354 MAMIHIKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDILRPIKVNLIFPVIYLLF 433
Cdd:TIGR00911 357 LSMIHVKRLTPLPSLLIVCTLTLLMLFSGDIYSLINLISFANWLFNALAVAGLLWLRYKRPEMNRPIKVPLFFPVFFLLS 436
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148233624  434 WAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVHWQNKPECFNNFVDAVTRAGQKLCVVVYPQ 497
Cdd:TIGR00911 437 CLFLIILSLYSPPVGCGVGFIIMLTGVPVYFFGVWWQNKPKWFRYLIVSKTVLLQKVLEVVKPQ 500
 
Name Accession Description Interval E-value
2A0304 TIGR00907
amino acid permease (GABA permease); [Transport and binding proteins, Amino acids, peptides ...
69-378 1.11e-06

amino acid permease (GABA permease); [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 233178  Cd Length: 482  Bit Score: 49.74  E-value: 1.11e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   69 AGSVGMALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGG--------LAGFLRLWIAVLVIYPTN------ 134
Cdd:TIGR00907  43 SGGAMSIVWGWIIAGAGSICIALSLAELSSAYPTSGGQYFWSAKLAPPrqmpfaswMTGWFNLAGQVAGTASTDlsvaql 122
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  135 -QAVIALT--FSNYVLQPLFptcfapesgLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAGKLLALGLIIIMGIVQICk 211
Cdd:TIGR00907 123 iLGIVSLTtpGREYIPTRWH---------IFGIMIGIHLIHALINSLPTKWLPRITSSAAYWSLLGFLTICITLLACKS- 192
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  212 GEYFwlEPKNAFENFQEPDIGL--IALAFLQGsFAYGGWNFLNY-----VTEELVNPYKNLPRAIfisIPLVTFVYVFA- 283
Cdd:TIGR00907 193 PKFN--DGKFVFTNFNNSTGGWkpGGFAFLLG-LLNPAWSMTGYdgtahMAEEIENPEVVGPRAI---IGAVAIGIVTGf 266
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  284 --NIAYVTAMSPQELLASNAVAVTFGEKLLGVM-----AWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLP--SLM 354
Cdd:TIGR00907 267 cfNIVLFFSMGDIDSLISSTTGQPIAQIFYNALgnkagAIFLLCLILVTSFFCAITCMTANSRMIYAFSRDGGLPfsPLW 346
                         330       340
                  ....*....|....*....|....
gi 148233624  355 AMIHIKRCTPIPALLFTCISTLLM 378
Cdd:TIGR00907 347 SRVNPRTQVPLNAVWLSAVWIILI 370
2A0308 TIGR00911
L-type amino acid transporter; [Transport and binding proteins, Amino acids, peptides and ...
34-497 0e+00

L-type amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 233179 [Multi-domain]  Cd Length: 501  Bit Score: 703.81  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   34 VALKKEIGLVSACGIIVGNIIGSGIFVSPKGVMENAGSVGMALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDI 113
Cdd:TIGR00911  38 VALKKEITLLSGVGIIVGTIIGSGIFVSPKGVLKNAGSVGLALIMWAVCGIFSIVGALVYAELGTTIPKSGGEYNYILEV 117
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  114 FGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFAPESGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAG 193
Cdd:TIGR00911 118 FGPLLAFLRLWIELLVIRPGSQAVNALNFAIYILTPVFPDCEVPEWAIRLVAVLCVLLLTLVNCLSVKWATRVQDIFTAC 197
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  194 KLLALGLIIIMGIVQICKGEYFWLEPKNAFENFqEPDIGLIALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFISI 273
Cdd:TIGR00911 198 KLLALLLIIITGWVQLGKGGVESLNPKNAFEGT-ETSAGGIVLAFYSGIWAYGGWNYLNFVTEEVKNPYRTLPIAIIISM 276
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  274 PLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSL 353
Cdd:TIGR00911 277 PIVTFIYVLTNIAYFTVLSPEELLASLAVAVDFGERLLGVMSWAMPALVGLSCFGSVNGSLFSSSRLFFVGGREGHLPSL 356
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  354 MAMIHIKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDILRPIKVNLIFPVIYLLF 433
Cdd:TIGR00911 357 LSMIHVKRLTPLPSLLIVCTLTLLMLFSGDIYSLINLISFANWLFNALAVAGLLWLRYKRPEMNRPIKVPLFFPVFFLLS 436
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148233624  434 WAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVHWQNKPECFNNFVDAVTRAGQKLCVVVYPQ 497
Cdd:TIGR00911 437 CLFLIILSLYSPPVGCGVGFIIMLTGVPVYFFGVWWQNKPKWFRYLIVSKTVLLQKVLEVVKPQ 500
PotE COG0531
Amino acid transporters [Amino acid transport and metabolism]
35-469 1.55e-48

Amino acid transporters [Amino acid transport and metabolism]


Pssm-ID: 223605 [Multi-domain]  Cd Length: 466  Bit Score: 175.35  E-value: 1.55e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  35 ALKKEIGLVSAC-GIIVGNIIGSGIFVSPKGVmenAGSVGMALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDI 113
Cdd:COG0531    9 ELKKKLGLFDLLtALGVGSMIGSGIFALPGSA---AGLAPAAILAWLIAGIIILFLALSYAELSSAIPSAGGAYAYAKRA 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 114 FGGLAGFLRLWIAVLViYPTNQAVIALTFSNYV--LQPLFPTCFAPESGLRLLAAVCLLLLTWVNCASVRWATRVQDIFT 191
Cdd:COG0531   86 LGPRLGFLAGWLYLLA-YVIALAAIAIGAASYLsyLFPGPGLLSIGPLLIILIALALIALLTLLNLRGIKASAKINSIIT 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 192 AGKLLALGLIIIMGIVQIckgeYFWLEPKNAFENFQEPDIGLIALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFI 271
Cdd:COG0531  165 ILKIIILLIFIILGLFAF----GFSNGNLFAPFNPGGGSFGGILAAILLAFFAFTGFEAIATLAEEVKNPKRTIPRAIIL 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 272 SIPLVTFVYVFANIAYVTAMSPQELLASN---AVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREG 348
Cdd:COG0531  241 SLLIVLILYILGALVIVGVLPAGDLAASApsaPLALAALFGGGNWGAIIIAILALLSLFGSLLAWILAVSRVLYAMARDG 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 349 HLPSLMAMIHIKRCTPIPALLFTCISTLLMLV-----TSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDILRPIKVN 423
Cdd:COG0531  321 LLPKFFAKVNPKGRTPVIALILTGIISLILLLlfplsSIAFNALVSLASVAFLIAYLLVALALLVLRRKKPDLKRPFRLP 400
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*..
gi 148233624 424 LIFPVIYLLF-WAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVHW 469
Cdd:COG0531  401 LAPLIPILGIvAVLLLLYALYASGLPPLLLGVILIAGGIIIYLLVYL 447
AA_permease_2 pfam13520
Amino acid permease;
40-447 2.30e-46

Amino acid permease;


Pssm-ID: 257840 [Multi-domain]  Cd Length: 425  Bit Score: 168.26  E-value: 2.30e-46
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   40 IGLVSACGIIVGNIIGSGIFVSPkgvmeNAGSVGMALIVWIVTGVITAV--GALCYAELGVTIPKSGGDYSYVKDIFGGL 117
Cdd:pfam13520   1 LSLLSAFALVIGSIIGSGIFVTP-----LIASAGAAAILWGWIAALIFSlaVALVYAELSSAFPRNGGIYVWLKNAFGKP 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  118 AGFLRLWIAVLVIYPTNQAVIALTFSnYVLQPLFPTCFAPESGLRLLAAVCLLLLTWVNCASVRWATRVQDI-FTAGKLL 196
Cdd:pfam13520  76 VAFIAAWFNWLAYILGLASSSSVAAS-YLLSAFGPDLVGNTWLTYGIAIAILIIFALINIRGIKESAKIQNIlGIVKLLL 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  197 ALGLIIIMGIVQICKGEYfwLEPKNAFENFQEPDIGLIALAFLQGSFAYGGWNFLNYVTEElvNPYKNLPRAIFISIPLV 276
Cdd:pfam13520 155 PLILIILLGLVLASGGGF--NLLPNSWTTFFPSGWPGVFLGLLVVLWSFGGFESAANVSEE--VKKRDVPKALFIGLLIV 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  277 TFVYVFANIAYVTAMSPQELLASNA---VAVTFGEKLLG-VMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPS 352
Cdd:pfam13520 231 GVLYLLVNILFLGVVPDDEIAKLNNlpsVAALLFEAVGGpWGAIIVAILLALSLLGAVNTAIVASSRVLEALARDGVLPK 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  353 LMAMIHiKRCTPIPALLFTCISTLLMLV-----TSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDILRPIKVnLIFP 427
Cdd:pfam13520 311 FFAKVN-KFGSPVRAIILTAILSLILLLlfllgGAAYNALLSLSAVGYLLVYLLLIIGLLILRKKRPDLPRIKGR-WPVA 388
                         410       420
                  ....*....|....*....|
gi 148233624  428 VIYLLFWAFLLVFSLWSEPV 447
Cdd:pfam13520 389 ILAILFILFLLVALFFPPGG 408
frlA PRK11357
putative fructoselysine transporter; Provisional
36-464 1.78e-27

putative fructoselysine transporter; Provisional


Pssm-ID: 183096 [Multi-domain]  Cd Length: 445  Bit Score: 113.41  E-value: 1.78e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  36 LKKEIGLVSACGIIVGNIIGSGIFVSPKGVMENAGSVGMALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFG 115
Cdd:PRK11357   6 LQRKLGFWAVLAIAVGTTVGSGIFVSVGEVAKAAGTPWLTVLAFVIGGLIVIPQMCVYAELSTAYPENGADYVYLKNAGS 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 116 GLAGFLRLWIAVLVIYPTNQAVIALTFSNYVlqplfpTCFAPESGLRL--LAAVCLLLLTWVNCASVRWATRVQDIFTAG 193
Cdd:PRK11357  86 RPLAFLSGWASFWANDAPSLSIMALAIVSNL------GFLTPIDPLLGkfIAAGLIIAFMLLHLRSVEGGAAFQTLITIA 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 194 KLLALGLIIIMGIVQIcKGEYFWLEPKNAFEnfQEPDIGLIALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFISI 273
Cdd:PRK11357 160 KIIPFTIVIGLGIFWF-KAENFAAPTTTAIG--ATGSFMALLAGISATSWSYTGMASICYMTGEIKNPGKTMPRALIGSC 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 274 PLVTFVYVFANIAYVTAMSPQELLASN---AVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHL 350
Cdd:PRK11357 237 LLVLVLYTLLALVISGLMPFDKLANSEtpiSDALTWIPALGSTAGIFVAITAMIVILGSLSSCVMYQPRLEYAMAKDNLF 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 351 PSLMAMIHIKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRwkKPDILRPIKVNLIFPVIY 430
Cdd:PRK11357 317 FKCFGHVHPKYNTPDVSIILQGALGIFFIFVSDLTSLLGYFTLVMCFKNTLTFGSIIWCR--KRDDYKPLWRTPAFGLMT 394
                        410       420       430
                 ....*....|....*....|....*....|....*...
gi 148233624 431 LLFWA--FLLVFSLWSEPVVCGI--GLAIMLTGVPVYF 464
Cdd:PRK11357 395 TLAIAssLILVASTFVWAPIPGLicAVIVIATGLPAYA 432
 
Name Accession Description Interval E-value
2A0304 TIGR00907
amino acid permease (GABA permease); [Transport and binding proteins, Amino acids, peptides ...
69-378 1.11e-06

amino acid permease (GABA permease); [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 233178  Cd Length: 482  Bit Score: 49.74  E-value: 1.11e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   69 AGSVGMALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGG--------LAGFLRLWIAVLVIYPTN------ 134
Cdd:TIGR00907  43 SGGAMSIVWGWIIAGAGSICIALSLAELSSAYPTSGGQYFWSAKLAPPrqmpfaswMTGWFNLAGQVAGTASTDlsvaql 122
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  135 -QAVIALT--FSNYVLQPLFptcfapesgLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAGKLLALGLIIIMGIVQICk 211
Cdd:TIGR00907 123 iLGIVSLTtpGREYIPTRWH---------IFGIMIGIHLIHALINSLPTKWLPRITSSAAYWSLLGFLTICITLLACKS- 192
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  212 GEYFwlEPKNAFENFQEPDIGL--IALAFLQGsFAYGGWNFLNY-----VTEELVNPYKNLPRAIfisIPLVTFVYVFA- 283
Cdd:TIGR00907 193 PKFN--DGKFVFTNFNNSTGGWkpGGFAFLLG-LLNPAWSMTGYdgtahMAEEIENPEVVGPRAI---IGAVAIGIVTGf 266
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  284 --NIAYVTAMSPQELLASNAVAVTFGEKLLGVM-----AWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLP--SLM 354
Cdd:TIGR00907 267 cfNIVLFFSMGDIDSLISSTTGQPIAQIFYNALgnkagAIFLLCLILVTSFFCAITCMTANSRMIYAFSRDGGLPfsPLW 346
                         330       340
                  ....*....|....*....|....
gi 148233624  355 AMIHIKRCTPIPALLFTCISTLLM 378
Cdd:TIGR00907 347 SRVNPRTQVPLNAVWLSAVWIILI 370
2A0308 TIGR00911
L-type amino acid transporter; [Transport and binding proteins, Amino acids, peptides and ...
34-497 0e+00

L-type amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 233179 [Multi-domain]  Cd Length: 501  Bit Score: 703.81  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   34 VALKKEIGLVSACGIIVGNIIGSGIFVSPKGVMENAGSVGMALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDI 113
Cdd:TIGR00911  38 VALKKEITLLSGVGIIVGTIIGSGIFVSPKGVLKNAGSVGLALIMWAVCGIFSIVGALVYAELGTTIPKSGGEYNYILEV 117
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  114 FGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFAPESGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAG 193
Cdd:TIGR00911 118 FGPLLAFLRLWIELLVIRPGSQAVNALNFAIYILTPVFPDCEVPEWAIRLVAVLCVLLLTLVNCLSVKWATRVQDIFTAC 197
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  194 KLLALGLIIIMGIVQICKGEYFWLEPKNAFENFqEPDIGLIALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFISI 273
Cdd:TIGR00911 198 KLLALLLIIITGWVQLGKGGVESLNPKNAFEGT-ETSAGGIVLAFYSGIWAYGGWNYLNFVTEEVKNPYRTLPIAIIISM 276
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  274 PLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSL 353
Cdd:TIGR00911 277 PIVTFIYVLTNIAYFTVLSPEELLASLAVAVDFGERLLGVMSWAMPALVGLSCFGSVNGSLFSSSRLFFVGGREGHLPSL 356
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  354 MAMIHIKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDILRPIKVNLIFPVIYLLF 433
Cdd:TIGR00911 357 LSMIHVKRLTPLPSLLIVCTLTLLMLFSGDIYSLINLISFANWLFNALAVAGLLWLRYKRPEMNRPIKVPLFFPVFFLLS 436
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148233624  434 WAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVHWQNKPECFNNFVDAVTRAGQKLCVVVYPQ 497
Cdd:TIGR00911 437 CLFLIILSLYSPPVGCGVGFIIMLTGVPVYFFGVWWQNKPKWFRYLIVSKTVLLQKVLEVVKPQ 500
PotE COG0531
Amino acid transporters [Amino acid transport and metabolism]
35-469 1.55e-48

Amino acid transporters [Amino acid transport and metabolism]


Pssm-ID: 223605 [Multi-domain]  Cd Length: 466  Bit Score: 175.35  E-value: 1.55e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  35 ALKKEIGLVSAC-GIIVGNIIGSGIFVSPKGVmenAGSVGMALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDI 113
Cdd:COG0531    9 ELKKKLGLFDLLtALGVGSMIGSGIFALPGSA---AGLAPAAILAWLIAGIIILFLALSYAELSSAIPSAGGAYAYAKRA 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 114 FGGLAGFLRLWIAVLViYPTNQAVIALTFSNYV--LQPLFPTCFAPESGLRLLAAVCLLLLTWVNCASVRWATRVQDIFT 191
Cdd:COG0531   86 LGPRLGFLAGWLYLLA-YVIALAAIAIGAASYLsyLFPGPGLLSIGPLLIILIALALIALLTLLNLRGIKASAKINSIIT 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 192 AGKLLALGLIIIMGIVQIckgeYFWLEPKNAFENFQEPDIGLIALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFI 271
Cdd:COG0531  165 ILKIIILLIFIILGLFAF----GFSNGNLFAPFNPGGGSFGGILAAILLAFFAFTGFEAIATLAEEVKNPKRTIPRAIIL 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 272 SIPLVTFVYVFANIAYVTAMSPQELLASN---AVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREG 348
Cdd:COG0531  241 SLLIVLILYILGALVIVGVLPAGDLAASApsaPLALAALFGGGNWGAIIIAILALLSLFGSLLAWILAVSRVLYAMARDG 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 349 HLPSLMAMIHIKRCTPIPALLFTCISTLLMLV-----TSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDILRPIKVN 423
Cdd:COG0531  321 LLPKFFAKVNPKGRTPVIALILTGIISLILLLlfplsSIAFNALVSLASVAFLIAYLLVALALLVLRRKKPDLKRPFRLP 400
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*..
gi 148233624 424 LIFPVIYLLF-WAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVHW 469
Cdd:COG0531  401 LAPLIPILGIvAVLLLLYALYASGLPPLLLGVILIAGGIIIYLLVYL 447
AA_permease_2 pfam13520
Amino acid permease;
40-447 2.30e-46

Amino acid permease;


Pssm-ID: 257840 [Multi-domain]  Cd Length: 425  Bit Score: 168.26  E-value: 2.30e-46
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   40 IGLVSACGIIVGNIIGSGIFVSPkgvmeNAGSVGMALIVWIVTGVITAV--GALCYAELGVTIPKSGGDYSYVKDIFGGL 117
Cdd:pfam13520   1 LSLLSAFALVIGSIIGSGIFVTP-----LIASAGAAAILWGWIAALIFSlaVALVYAELSSAFPRNGGIYVWLKNAFGKP 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  118 AGFLRLWIAVLVIYPTNQAVIALTFSnYVLQPLFPTCFAPESGLRLLAAVCLLLLTWVNCASVRWATRVQDI-FTAGKLL 196
Cdd:pfam13520  76 VAFIAAWFNWLAYILGLASSSSVAAS-YLLSAFGPDLVGNTWLTYGIAIAILIIFALINIRGIKESAKIQNIlGIVKLLL 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  197 ALGLIIIMGIVQICKGEYfwLEPKNAFENFQEPDIGLIALAFLQGSFAYGGWNFLNYVTEElvNPYKNLPRAIFISIPLV 276
Cdd:pfam13520 155 PLILIILLGLVLASGGGF--NLLPNSWTTFFPSGWPGVFLGLLVVLWSFGGFESAANVSEE--VKKRDVPKALFIGLLIV 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  277 TFVYVFANIAYVTAMSPQELLASNA---VAVTFGEKLLG-VMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPS 352
Cdd:pfam13520 231 GVLYLLVNILFLGVVPDDEIAKLNNlpsVAALLFEAVGGpWGAIIVAILLALSLLGAVNTAIVASSRVLEALARDGVLPK 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  353 LMAMIHiKRCTPIPALLFTCISTLLMLV-----TSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDILRPIKVnLIFP 427
Cdd:pfam13520 311 FFAKVN-KFGSPVRAIILTAILSLILLLlfllgGAAYNALLSLSAVGYLLVYLLLIIGLLILRKKRPDLPRIKGR-WPVA 388
                         410       420
                  ....*....|....*....|
gi 148233624  428 VIYLLFWAFLLVFSLWSEPV 447
Cdd:pfam13520 389 ILAILFILFLLVALFFPPGG 408
2A0306 TIGR00909
amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines].
36-465 2.20e-34

amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 129987 [Multi-domain]  Cd Length: 429  Bit Score: 133.34  E-value: 2.20e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   36 LKKEIGLVSACGIIVGNIIGSGIFVSpkgVMENAGSVGMALIV-WIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIF 114
Cdd:TIGR00909   1 LSRELGLFDLTMLGIGAMIGTGIFVV---TGIAAGKAGPAVILsFVLAGLTALFIALVYAELAAMLPVAGSPYTYAYEAM 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  115 GGLAGFLRLWIAVLViYPTNQAVIALTFSNYV--------LQPLFPTCFAPESGLRLL--AAVCLLLLTWVNCASVRWAT 184
Cdd:TIGR00909  78 GELTAFIIGWSLWLE-YGVAVAAVAVGWGGYLqeflpgvgLDLPAVLTAKPGNGGVFNlpALLIVLFLTYILYLGAKESG 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  185 RVQDIFTAGKLLALGLIIIMGIVQICKGEYfwlepknafENFQEPDIGLIALAFLQGSFAYGGWNFLNYVTEELVNPYKN 264
Cdd:TIGR00909 157 KVNDILVVLKVAALLLFAALGAIHFASNNY---------TPFMPMGFGGVGAATALVFFAFIGFEAISTAAEEVKNPERD 227
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  265 LPRAIFISIPLVTFVYVFANiAYVTAMSPQELLASN--AVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFF 342
Cdd:TIGR00909 228 IPKAIILSLIVVTLLYVLVA-AVILGAVPWRQLAGStaPLSLVGYDLGQGIGGLILTAGAVFSIASVMLAGIYGTSRVLF 306
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  343 AGAREGHLPSLMAMIHIKRCTP-IPALLFTCISTLL-MLVTSDMYTLINYVGFInyLFYGVTVAGQIVLRWKKPDILRPI 420
Cdd:TIGR00909 307 AMSRDGLLPGSLSKVHPKTGTPhMSIIIFSLTAALLaSLVPLEGLAELTSIGTL--IAFAAVNVAVIILRRRRPDIQRAF 384
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|....*
gi 148233624  421 KVNLIfPVIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFL 465
Cdd:TIGR00909 385 RCPLV-PVLPVLVVSYCIYLLLNLGPGTTVWFLVWMLLGSVFYFI 428
frlA PRK11357
putative fructoselysine transporter; Provisional
36-464 1.78e-27

putative fructoselysine transporter; Provisional


Pssm-ID: 183096 [Multi-domain]  Cd Length: 445  Bit Score: 113.41  E-value: 1.78e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  36 LKKEIGLVSACGIIVGNIIGSGIFVSPKGVMENAGSVGMALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFG 115
Cdd:PRK11357   6 LQRKLGFWAVLAIAVGTTVGSGIFVSVGEVAKAAGTPWLTVLAFVIGGLIVIPQMCVYAELSTAYPENGADYVYLKNAGS 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 116 GLAGFLRLWIAVLVIYPTNQAVIALTFSNYVlqplfpTCFAPESGLRL--LAAVCLLLLTWVNCASVRWATRVQDIFTAG 193
Cdd:PRK11357  86 RPLAFLSGWASFWANDAPSLSIMALAIVSNL------GFLTPIDPLLGkfIAAGLIIAFMLLHLRSVEGGAAFQTLITIA 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 194 KLLALGLIIIMGIVQIcKGEYFWLEPKNAFEnfQEPDIGLIALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFISI 273
Cdd:PRK11357 160 KIIPFTIVIGLGIFWF-KAENFAAPTTTAIG--ATGSFMALLAGISATSWSYTGMASICYMTGEIKNPGKTMPRALIGSC 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 274 PLVTFVYVFANIAYVTAMSPQELLASN---AVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHL 350
Cdd:PRK11357 237 LLVLVLYTLLALVISGLMPFDKLANSEtpiSDALTWIPALGSTAGIFVAITAMIVILGSLSSCVMYQPRLEYAMAKDNLF 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 351 PSLMAMIHIKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRwkKPDILRPIKVNLIFPVIY 430
Cdd:PRK11357 317 FKCFGHVHPKYNTPDVSIILQGALGIFFIFVSDLTSLLGYFTLVMCFKNTLTFGSIIWCR--KRDDYKPLWRTPAFGLMT 394
                        410       420       430
                 ....*....|....*....|....*....|....*...
gi 148233624 431 LLFWA--FLLVFSLWSEPVVCGI--GLAIMLTGVPVYF 464
Cdd:PRK11357 395 TLAIAssLILVASTFVWAPIPGLicAVIVIATGLPAYA 432
AA_permease pfam00324
Amino acid permease;
48-442 2.47e-26

Amino acid permease;


Pssm-ID: 249769 [Multi-domain]  Cd Length: 472  Bit Score: 110.51  E-value: 2.47e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   48 IIVGNIIGSGIFVSPKGVMENAGSVGmALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWI-- 125
Cdd:pfam00324   5 IALGGVIGTGLFVGSGSVLGQAGPAG-ALLGYLISGVVIFLVMLSLGEMSTNGPVAGGFYAYASRFLGPSLGFATGWNyw 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  126 ---AVLVIYPTNQAVIALTFSNYVLQPLfptcfapesGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAGKLLAL-GLI 201
Cdd:pfam00324  84 lswITVLALELTAASILIQFWELVPDIP---------YTWGWGAVFIVLLLIINLVGVKGYGEAEFWFALIKVIAIiAFI 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  202 IIMGIVQICKG----EYFWLEP--KNAFENFQEPDIGL---IALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFIS 272
Cdd:pfam00324 155 IVGVIILLSGGgpndGAYLGDNggKNNFPPGFAPGGGSfanFISVFVIAFFAFTGIELVGIAAGEVKNPEKSIPKAILQV 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  273 IPLVTFVYVFANIAYVTAMSPQELLASNAVAVTFG-----EKLLGVMAW--IMPISVALSTFGGVNGSLFTSSRLFFAGA 345
Cdd:pfam00324 235 VWRITIFYILSLLAIGLLVPWNDPGLLADSASAASpfvifFKSLGISGLapLINAVILTAALSAANSSLYSGSRMLYALA 314
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  346 REGHLPSLMAmIHIKRCTPIPALLFTCISTLLMLVTSDMYT------LINYVGFINYLFYGVTVAGQIvlRWKKPDILRP 419
Cdd:pfam00324 315 RDGLAPKFLK-KVDKSGVPLRAILLSTAISLLAVLLASLNPaivfnfLLAISGLSGLIVWGLISLSHL--RFRKAFKYQG 391
                         410       420
                  ....*....|....*....|...
gi 148233624  420 IKVNLIFPVIYLLFWAFLLVFSL 442
Cdd:pfam00324 392 RSIDELPFKAPLGPFGVILGLAA 414
2A0305 TIGR00908
ethanolamine permease; The three genes used as the seed for this model (from Burkholderia ...
35-465 8.08e-21

ethanolamine permease; The three genes used as the seed for this model (from Burkholderia pseudomallei, Pseudomonas aeruginosa and Clostridium acetobutylicum are all adjacent to genes for the catabolism of ethanolamine. Most if not all of the hits to this model have a similar arrangement of genes. This group is a member of the Amino Acid-Polyamine-Organocation (APC) Superfamily [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 129986 [Multi-domain]  Cd Length: 442  Bit Score: 93.75  E-value: 8.08e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   35 ALKKEIGLVSACGIIVGNIIgSGIFVSPKGVMENAGSVGMALIVWIVTGVITAVgALCYAELGVTIPKSGGDYSYVKDIF 114
Cdd:TIGR00908   4 QLKKTLATWQLWGIGVGYVI-SGDYAGWNFGLAQGGWGGFVVATLLVATMYLTF-CFSLAELSTMIPTAGGGYGFARRAF 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  115 GGLAGFLRlWIAVLVIYPTNQAVIALTFSNYVlQPLFPTcfapeSGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAgk 194
Cdd:TIGR00908  82 GPWGGFLA-GTAILIEFAFAPPAIACFIGAYC-ESLFPV-----GPGWLAALVFYIVFIGINILGVGEAAKLEFVVTA-- 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  195 LLALGLIIIMGIVQIckgeyfWLEPKNAFENFQEPDIGLIALAFlQGSFA---YGGWNFLN-----YVTEELVNPYKNLP 266
Cdd:TIGR00908 153 VAIIALGVFIGAMVP------HFDSANLFNGPQTGASSFLPGAY-VGVFAaipFAIWFFLAvegvaMAAEETKNPKRDIP 225
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  267 RAIFISIplVTFVYVFANIAYVT--AMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGV---NGSLFTSSRLF 341
Cdd:TIGR00908 226 RGLIGAI--LTLLALAAGILVVGpgAADAKELMGSNNPLPEALESIYGGSTWMSQFVNLVGLFGLIasfHGIIYGYSRQI 303
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  342 FAGAREGHLPSLMAMIHIKRcTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDILRPIK 421
Cdd:TIGR00908 304 FALSRAGYLPESLSKVNRKK-APVLAIVVPGVIGFGLSLTGQTALIILVSVFGAIISYVLSMAAHFTLRIRRPDMERPYR 382
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|....*..
gi 148233624  422 VNL--IFPVIYLLFWAFLLVFSLWSEP-VVCGIGLAIMLTGVpVYFL 465
Cdd:TIGR00908 383 TPGgiLTPGVALVLACVALVTGFYVDPrVVVGAVAIFVVLIG-YYFL 428
2A0302 TIGR00905
transporter, basic amino acid/polyamine antiporter (APA) family; This family includes several ...
38-479 2.36e-20

transporter, basic amino acid/polyamine antiporter (APA) family; This family includes several families of antiporters that, rather commonly, are encoded next to decarboxylases that convert one of the antiporter substrates into the other. This arrangement allows a cycle that can remove proteins from the cytoplasm and thereby protect against acidic conditions [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 129983 [Multi-domain]  Cd Length: 473  Bit Score: 92.81  E-value: 2.36e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   38 KEIGLVSACGIIVGNIIGSGIFVSPKGvMENAGSVGMALIVWIVTGVITAVGALCYAELGVTIP-KSGGDYSYVKDIFGG 116
Cdd:TIGR00905   7 KKLGLFALTALVIGSMIGSGIFSLPQN-LASVAGPGAVIIGWIITGVGMLALAFVFAILATKKPeLDGGIYAYAREGFGP 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  117 LAGF-------LRLWIAVLVIyptnqAVIALTFSNYVLqPLFptcfapESGLRLLAAVCLLLLTW----VNCASVRWATR 185
Cdd:TIGR00905  86 YIGFmsgwgywLSAWIGNVAY-----AVLLFSALGYFF-PLF------GSGNPVPSILGASVLLWvftfLVLRGVRQAAF 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  186 VQDIFTAGKLLALGLIIIMGIvqickgeyFWLEP---KNAFENFQEPDIGLIALAfLQGSFAYGGWNFLNY----VTEEL 258
Cdd:TIGR00905 154 INTITTIAKLIPLFLFIIIGW--------FWFKLdlfTADFWGHDVPSLGSVFSQ-VKNTMLVTLWVFIGIegavVSSGR 224
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  259 VNPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELLAS-NAVAVTFGEKLLG-VMAWIMPISVALSTFGGVNGSLFT 336
Cdd:TIGR00905 225 AKNKSDVGKATVLGTLGALVIYILITLLSLGVLPQQELANLpNPSMAAVLEMIVGkWGAVLISLGLIISVLGSLLSWTML 304
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  337 SSRLFFAGAREGHLPSLMAMIHiKRCTPIPALLFT--CISTLLMLV--TSDMY-TLINYVGFINYLFYGVTVAGQIVLRW 411
Cdd:TIGR00905 305 AAEVPFSAAKDGLFPKIFGRVN-KNGAPSVALLLTniLIQLFLLLTllTSSAYnVLVSLAVVMILVPYLLSAAYLLKLAK 383
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 148233624  412 KKPDILRPIKVNLIFPVIYLLFwAFLLVFSlwSEPVVCGIGLAIMLTGVPVYFLGVHWQNKPEcFNNF 479
Cdd:TIGR00905 384 VGTYPKIKNRKALIVGVIACVY-SIWLLYA--AGLKYLLLGFILYAPGIIFYGRARKERGKHV-FNKK 447
2A0303 TIGR00906
cationic amino acid transport permease; [Transport and binding proteins, Amino acids, peptides ...
50-412 1.74e-19

cationic amino acid transport permease; [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 129984 [Multi-domain]  Cd Length: 557  Bit Score: 90.26  E-value: 1.74e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   50 VGNIIGSGIFVSPKGVMENagSVGMALIV-WIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVL 128
Cdd:TIGR00906  40 IGSTIGAGIYVLTGEVARN--DSGPAIVLsFLISGLAAVLSGFCYAEFGARVPKAGSAYLYSYVTVGELWAFITGWNLIL 117
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  129 VIYPTNQAVI---ALTFSNYVLQPL---FPTCFA-PESGLRLLAAVCLLLLTWVNCA----SVRWATRVQDIFTAGKLLA 197
Cdd:TIGR00906 118 EYVIGTAAVArswSAYFDELLNKQIgqfRRTYFKlNYDGLAEYPDFFAVCLILLLAVllsfGVKESAWVNKIFTAINILV 197
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  198 LGLIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLIALA---FlqgsFAYGGWNFLNYVTEELVNPYKNLPRAIFISIp 274
Cdd:TIGR00906 198 LLFVIIAGFTKADVANWSITEEKGAGGFMPYGFTGVLSGAatcF----FAFIGFDAIATTGEEVKNPQRAIPIGIVTSL- 272
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  275 LVTFVYVFANIAYVTAMSPQELLASNA-VAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSL 353
Cdd:TIGR00906 273 LVCFVAYFLMSAALTLMMPYYLLDPDApFPVAFEYVGWGPAKYIVAVGALCGMSTSLLGGMFPLPRVIYAMARDGLLFKW 352
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 148233624  354 MAMIHIKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWK 412
Cdd:TIGR00906 353 LAQINSKTKTPINATVVSGAIAALMAFLFDLKALVDLLSIGTLLAYSLVAACVLILRYQ 411
LysP COG0833
Amino acid transporters [Amino acid transport and metabolism]
48-408 2.45e-16

Amino acid transporters [Amino acid transport and metabolism]


Pssm-ID: 223903 [Multi-domain]  Cd Length: 541  Bit Score: 80.36  E-value: 2.45e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  48 IIVGNIIGSGIFVSPKGVMENAGSVGmALIVWIVTGVITAVGALCYAELGVTIPKSGG--DYS--YVKDIFGGLAGFLrL 123
Cdd:COG0833   54 IAIGGAIGTGLFVGSGKALSQAGPAG-LLIAYLIIGIMVYFVMQSLGELAVFYPVSGSfsTYAtrFVDPAFGFALGWN-Y 131
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 124 WIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFapesglrllAAVCLLLLTWVNCASVRWATRVQDIFTAGKLLALGLIII 203
Cdd:COG0833  132 WLNWAVTLPLELTAASLVIQYWFPDTVPPWIW---------IAIFLVLIFLLNLFGVKGFGETEFWFSSIKVLTIIGFII 202
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 204 MGIVQICK--------GEYFWLEPKnAFENfqepDIGLIALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFISIPL 275
Cdd:COG0833  203 LGIIIICGggpthgyiGFNYWHDPG-AFAG----GFKGFCSVFVIAAFSFSGTELVGLAAGESENPRKSIPKAIKQVFWR 277
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 276 VTFVYVFA--NIAYVTAMSPQELLASNAVAV-----TFGEKLLG--VMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAR 346
Cdd:COG0833  278 ILLFYILSifVIGLLVPYNDPRLLGNSSSGVaaspfVIAIKNAGipVAASIMNAVILTSVLSAANSGLYASSRMLYSLAK 357
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 148233624 347 EGHLPSLMAMIHiKRCTPIPALLFTCISTLLMLVTSdmytLINYVGFINYLFYGVTVAGQIV 408
Cdd:COG0833  358 QGKAPKIFAKVD-RRGVPLVALLVTLLFGLLAFLNS----SFKETTVFNWLLNISGLSGFIA 414
2A0310 TIGR00913
amino acid permease (yeast); [Transport and binding proteins, Amino acids, peptides and amines] ...
48-380 8.11e-14

amino acid permease (yeast); [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 233181 [Multi-domain]  Cd Length: 478  Bit Score: 72.31  E-value: 8.11e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   48 IIVGNIIGSGIFVSPKGVMENAGSVGMaLIVWIVTGVITAVGALCYAELGVTIPKSGGDYS-----YVKDIFGGLAGFLr 122
Cdd:TIGR00913  12 IALGGTIGTGLLVGSGTALATGGPAGL-LIGYAIMGSIIYCVMQSLGEMATFYPVVSGSFAtyasrFVDPAFGFAVGWN- 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  123 LWIAVLVIYPTNQAVIALTFSnYVLQPLFPTCFapesglrllAAVCLLLLTWVNCASVRWATRVQDIFTAGKLLALGLII 202
Cdd:TIGR00913  90 YWLQWLIVLPLELVTASMTIQ-YWTDKVNPAVW---------IAIFYVFIVIINLFGVKGYGEAEFWFSSIKILAIIGFI 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  203 IMGIVQICKG----EYF----WLEPKnAFENFQEPDIGL-IALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFISI 273
Cdd:TIGR00913 160 ILSIILNCGGgpnhGYIgfryWHDPG-AFAGGTIGGRFKgVCSVFVTAAFSFGGTELVALTAGEAANPRKSIPRAAKRTF 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  274 PLVTFVYVFANIAY---VTAMSPQELLASNAVAV----------TFGEKllgVMAWIMPISVALSTFGGVNGSLFTSSRL 340
Cdd:TIGR00913 239 WRILVFYILTLFLIgflVPYNDPRLLSSSSSSDSaaspfviaiqNHGIK---VLPHIFNAVILISVLSAANSSLYASSRT 315
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|
gi 148233624  341 FFAGAREGHLPSLMAMIHiKRCTPIPALLFTCISTLLMLV 380
Cdd:TIGR00913 316 LYALAHQGLAPKIFAYVD-RRGVPYVAVIVSSLFGLLAFL 354
his_histam_anti TIGR04298
histidine-histamine antiporter; Members of this protein family are antiporters that exchange ...
39-382 1.35e-13

histidine-histamine antiporter; Members of this protein family are antiporters that exchange histidine with histamine, product of histidine decarboxylation. A system consisting of this protein, and a histidine decarboxylase encoded by an adjacent gene, creates decarboxylation/antiport proton-motive cycle that provides a transient resistance to acidic conditions.


Pssm-ID: 213911 [Multi-domain]  Cd Length: 429  Bit Score: 71.53  E-value: 1.35e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   39 EIGLVSACGIIVGNIIGSGIFVSPKgvmeNAGSVG-MALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGGL 117
Cdd:TIGR04298   1 KMGVIALTLVTASNMMGSGVFLLPT----NLAGIGaISIFGWIFTIIGVIALALVFAKTSLIHERIGGIVAYARDAFGPF 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  118 AGF---LRLWIAVLViyptnQAVIALTFSNYVLQPLFPTCFAPESGLR---LLAAVCLLLLTWVNCASVRWATRVQDiFT 191
Cdd:TIGR04298  77 IGFqstIAYWISAWI-----GNVALLVAGVGYLAFFFPELKDPTVGTTygcIAAIIILWAFVFLASFGAKVAGRAQS-FT 150
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  192 AgkllALGLIIIMGIVQIckgEYFWLEPKNAFENFQepDIGLIALAFLQGSFAYGGWNFLN-----YVTEELVNPYKNLP 266
Cdd:TIGR04298 151 A----ICGLAVILGVGIF---GWFWFKPEMYLEVIN--ATGNSNFSAIIAAASIALWGFLGiesavVSTGQVENPEKTVP 221
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  267 RAIFISIPLVTFVYVfANIAYVTAMSPQELLA------SNAVAVTFGEKLLGVMAWIMPIsvaLSTFGGVNGSLFTSSRL 340
Cdd:TIGR04298 222 KATVMGLLIAAVCYV-ASCTVIAGIIPHEVLInsaapfADAAKYMFDNELAGNIASALSI---IACFGSISGWFILQSEA 297
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....
gi 148233624  341 FFAGAREGHLPSLMAMIHiKRCTPIPALLFTCI--STLLMLVTS 382
Cdd:TIGR04298 298 PRAAAEQGLFPKFFADLN-KNDVPMKSLIFTAIlmCCVLLLTAS 340
PRK10644 PRK10644
arginine:agmatin antiporter; Provisional
34-382 1.48e-13

arginine:agmatin antiporter; Provisional


Pssm-ID: 182613 [Multi-domain]  Cd Length: 445  Bit Score: 71.36  E-value: 1.48e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  34 VALKKEIGLVSACGIIVGNIIGSGIFVSPKGVmenAGSVGMALIVWIVTgVITAVG-ALCYAELGVTIPKSGGDYSYVKD 112
Cdd:PRK10644   4 DADAHKVGLIPVTLMVAGNIMGSGVFLLPANL---ASTGGIAIYGWLVT-IIGALGlSMVYAKMSSLDPSPGGSYAYARR 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 113 IFGGLAGF---LRLWIAVlVIYPTNQAVIALTFSNYvlqpLFPTCFAPESgLRLLAAVCLLLLTWVNCASVRWATRVQDI 189
Cdd:PRK10644  80 CFGPFLGYqtnVLYWLAC-WIGNIAMVVIGVGYLSY----FFPILKDPLV-LTITCVVVLWIFVLLNIVGPKMITRVQAV 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 190 FTagkllALGLIIIMGIVQIckgEYFWLEPKNAFENFQEPdiGLIALAFLQGSFAYGGWNFLNY----VTEELV-NPYKN 264
Cdd:PRK10644 154 AT-----VLALIPIVGIAVF---GWFWFRGETYMAAWNVS--GLGTFGAIQSTLNVTLWSFIGVesasVAAGVVkNPKRN 223
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 265 LPRAIFISIPLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKLLGVMAW-IMPISVALSTFGGVNGSLFTSSRLFFA 343
Cdd:PRK10644 224 VPIATIGGVLIAAVCYVLSSTAIMGMIPNAALRVSASPFGDAARMALGDTAGaIVSFCAAAGCLGSLGGWTLLAGQTAKA 303
                        330       340       350
                 ....*....|....*....|....*....|....*....
gi 148233624 344 GAREGHLPSLMAMIHiKRCTPIPALLFTCISTLLMLVTS 382
Cdd:PRK10644 304 AADDGLFPPIFARVN-KAGTPVAGLLIVGVLMTIFQLSS 341
AnsP COG1113
Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism]
48-464 5.01e-13

Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism]


Pssm-ID: 224038 [Multi-domain]  Cd Length: 462  Bit Score: 69.58  E-value: 5.01e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  48 IIVGNIIGSGIFVSPKGVMENAG-SVgmaLIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWI- 125
Cdd:COG1113   23 IAIGGAIGTGLFLGSGSAIAMAGpSV---LLAYLIAGIFVFLIMRALGEMLVANPVSGSFSDYARKYLGPWAGFLTGWTy 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 126 -AVLVIYPTNQAVIALTFSNYvlqplfptcFAPESGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAGKLLALGLIIIM 204
Cdd:COG1113  100 wFFWVLVGIAELTAIGIYLQF---------WFPDVPQWVFALAAVVLLLAVNLISVKVFGELEFWFALIKVAAIIAFIVV 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 205 GIVQICKG----------EYFWlepkNAFENFQEPDIGLIAlAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAI----- 269
Cdd:COG1113  171 GIVLLFGGfgggggaagfSNLW----DHGGFFPNGFLGFLS-ALQIVMFAFGGIELVGITAAEAKDPEKAIPKAInsviw 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 270 ----FISIPLVTFVYVFANIAYVTAMSPqellasnaVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGA 345
Cdd:COG1113  246 riliFYVGSLFVILSLYPWNQIGEDGSP--------FVTVFSLIGIPFAAGIMNFVVLTAALSALNSGLYSTSRMLYSLA 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 346 REGHLPSLMAMIHiKRCTPIPALLFTCISTLL-----MLVTSDMYTLI-NYVGFINYLFYGVTVAGQIVLRWKKPDILRP 419
Cdd:COG1113  318 KQGDAPKAFAKLS-KRGVPVNAILLSAVVLLLgvvlnYILPEKVFELVtSSSGLGLLFVWLMILLSQLKLRKAKPAEGKK 396
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|...
gi 148233624 420 IKVNLIF----PVIYLLFWAFLLVFSLW----SEPVVCGIGLAIMLTGVPVYF 464
Cdd:COG1113  397 LKFKMPLypftNYLTLAFLAFVLVLMLFdpdtRISLLVGPVWLVLLGIGYLVK 449
antiport_PotE TIGR04299
putrescine-ornithine antiporter; Members of this protein family are putrescine-ornithine ...
35-381 9.95e-11

putrescine-ornithine antiporter; Members of this protein family are putrescine-ornithine antiporter. They work together with an enzyme that decarboxylates ornithine to putrescine. This two-gene system has the net effect of removing a protein from the cytosol, providing transient resistance to acid conditions.


Pssm-ID: 213912 [Multi-domain]  Cd Length: 430  Bit Score: 62.22  E-value: 9.95e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   35 ALKKEIGLVSACGIIVGNIIGSGIFVSPKgvmeNAGSVG-MALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDI 113
Cdd:TIGR04299   1 AKKKKMSVVQLTILTAVNMMGSGIIMLPT----NLAQVGtMSIISWLVTAVGAMALAWAFARAGMYSSKSGGMGGYAEYS 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  114 FGGLAGFLRLWIAVLVIYPTNqAVIALTFSNYVLQPLFPTCFAPESGlrLLAAVCLLLLTWVNCASVRWATRVQDIFTAG 193
Cdd:TIGR04299  77 FGKAGNFMANYTYGVSLVIAN-AAIAISAVGYGAELLGAHLSPVQIA--LATIGVLWIATVLNFGGARITGQISSFTVWG 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  194 kllalgliIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLiaLAFLQGSFAYGGWNFLNYV-----TEELVNPYKNLPRA 268
Cdd:TIGR04299 154 --------VIIPVVGISIIGWFWFSGTLYADSWNPHHAGF--FSGVGSSISITLWAFLGLEsacanTDVVENPKKNVPIA 223
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  269 IFISIPLVTFVYVFANIAYVTAMSPQELLASNA-VAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGARE 347
Cdd:TIGR04299 224 VLGGTIGAAVMYIISTNVIAGIVPNMELANSNApFGLAFSQMFNPTVGKIVMGLMVISCFGSLLGWQFTIAEVFRSSADE 303
                         330       340       350
                  ....*....|....*....|....*....|....*
gi 148233624  348 GHLPSLMAMIhIKRCTP-IPALLFTCISTLLMLVT 381
Cdd:TIGR04299 304 GYFPKIFSKT-IGNGTPlIGMLIITILQSLLALMT 337
PRK11021 PRK11021
putative transporter; Provisional
40-380 9.88e-10

putative transporter; Provisional


Pssm-ID: 236823 [Multi-domain]  Cd Length: 410  Bit Score: 59.15  E-value: 9.88e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  40 IGLVSACGIIVGNIIGSGIFVSPKGVMENAGsvGMALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAG 119
Cdd:PRK11021   1 LGLWQGIGLLSTSLLGTGVFAVPALAALVAG--NNSLWAWPLLILLIFPIAIVFARLGRHFPHAGGPAHFVGMAFGPRLG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 120 FLRLWIAVLVIYPTNQAVIALTFSnyVLQPLFPtcfAPESGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTagkLLALG 199
Cdd:PRK11021  79 RVTGWLFLSVIPVGLPAALQIAAG--FGQALFG---WSSWQLLLAELLTLALLWLLNLRGASSSANLQTVIA---LLIVA 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 200 LI-IIMGIVQICKGEYFWLEPknafenfQEPDIGLIALAFlqgsfAYGGWNFLN-----YVTEELVNPYKNLPRAIFISI 273
Cdd:PRK11021 151 LVvAIWWAGDIKPADIPFPAP-------GSIEWSGLFAAL-----GVMFWCFVGieafaHLASEFKNPERDFPRALMIGL 218
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 274 PLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKLLGVMA-WIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPS 352
Cdd:PRK11021 219 LLAGLVYWACTVVVLHFPAYGDKQAAAASLPGIFVQLFGGYAlWVICVIGYLACFASVNIYTQSFARLVWSQAREGRPPS 298
                        330       340
                 ....*....|....*....|....*...
gi 148233624 353 LMAMIHiKRCTPIPALLFTCISTLLMLV 380
Cdd:PRK11021 299 YLARLS-ARGVPVNALNAVLGCCAVSIL 325
potE PRK10655
putrescine transporter; Provisional
37-381 4.81e-09

putrescine transporter; Provisional


Pssm-ID: 182622 [Multi-domain]  Cd Length: 438  Bit Score: 56.96  E-value: 4.81e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  37 KKEIGLVSACGIIVGNIIGSGIFVSPKgvmeNAGSVG-MALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFG 115
Cdd:PRK10655   5 SNKMGVVQLTILTAVNMMGSGIIMLPT----KLAQVGtISILSWLVTAVGSMALAYAFAKCGMFSRKSGGMGGYAEYAFG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 116 GLAGFLRLWIAVLVIYPTNQAvIALTFSNYvLQPLFPTCFAPeSGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAGKL 195
Cdd:PRK10655  81 KSGNFMANYTYGVSLLIANVA-IAISAVGY-GTELFGATLSP-VQICLATIGVLWLCTVANFGGARITGQISSVTVWGVI 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 196 LALGLIIIMGivqickgeYFWLEPkNAFENFQEPDiGLIALAFLQGSFAYGGWNFLNYV-----TEELVNPYKNLPRAIF 270
Cdd:PRK10655 158 IPVVGLSIIG--------WFWFSP-SLYVAAWNPH-HLPFFSAVGSSIAMTLWAFLGLEsacanSDAVENPERNVPIAVL 227
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 271 ISIPLVTFVYVFANIAYVTAMSPQELLASNA-----VAVTFGEkllGVMAWIMPISVaLSTFGGVNGSLFTSSRLFFAGA 345
Cdd:PRK10655 228 GGTLGAAVIYIVSTNVIAGIVPNMELANSTApfglaFAQMFNP---TVGKIVMALMV-MSCCGSLLGWQFTIAQVFKSSA 303
                        330       340       350
                 ....*....|....*....|....*....|....*..
gi 148233624 346 REGHLPSLMAMIhIKRCTPIPALLF-TCISTLLMLVT 381
Cdd:PRK10655 304 DEGYFPKIFSRV-TKVDAPVQGMLIiVVIQSLLSLMT 339
GABAperm TIGR01773
gamma-aminobutyrate permease; GABA permease (gabP) catalyzes the translocation of ...
48-460 8.63e-09

gamma-aminobutyrate permease; GABA permease (gabP) catalyzes the translocation of 4-aminobutyrate (GABA) across the plasma membrane, with homologues expressed in Gram-negative and Gram-positive organisms. This permease is a highly hydrophobic transmembrane protein consisting of 12 transmembrane domains with hydrophilic N- and C-terminal ends. Induced by nitrogen-limited culture conditions in both Escherichia coli and Bacillus subtilis, gabP is an energy dependent transport system stimulated by membrane potential and has been observed adjacent and distant from other GABA degradation proteins. GabP is highly homologous to amino acid permeases from B. subtilis, E. coli, as well as to other members of the amino acid permease family (pfam00324). A member of the APC (amine-polyamine-choline) transporter superfamily, GABA permease possesses a "consensus amphiphatic region" (CAR) found to be evolutionarily conserved within this transport family. This amphiphatic region is located between helix 8 and cytoplasmic loop 8-9, forming a potential channel domain and suggested to play a significant role in ligand recognition and translocation. Unique to GABA permeases, a conserved cysteine residue (CYS-300, E.coli) located at the beginning of the amphiphatic domain, has been determined to be critical for catalytic specificity [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 233567 [Multi-domain]  Cd Length: 452  Bit Score: 56.42  E-value: 8.63e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   48 IIVGNIIGSGIFVSPKGVMENAGSVgmALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGF----LRL 123
Cdd:TIGR01773  22 LSIAGVIGAGLFVGSGSAIASAGPA--ALLAYLLAGLLVVFIMRMLGEMAVANPDTGSFSTYADDAIGRWAGFtigwLYW 99
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  124 WIAVLVIypTNQAVIALTFSNYvlqplfptcFAPESGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAGKLLALGLIII 203
Cdd:TIGR01773 100 WFWVLVI--PLEAIAAAGILQY---------WFPDIPLWLFSLILTIVLTLTNLYSVKSYGEFEFWFALIKVIAIIAFII 168
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  204 MGIVQICkGEYFWLEPKN-----AFENFQEPDIGLIALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRA---IFISIPL 275
Cdd:TIGR01773 169 LGAVAIF-GFAPGSEVSGfsnltGKGGFFPNGIGAVLLAILVTMFSFMGTEIVTIAAAESSNPIKSITRAtnsVIWRIIV 247
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  276 VTFVYVFANIAYVTAMSPQELLASNAVAVTfgeKLLGV--MAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSL 353
Cdd:TIGR01773 248 FYLGSIFIVVALLPWNSPNLLEVGSYVAVL---ELLGIphAKLIMDFVVLTAVLSCLNSALYTTSRMLYSLAERGDAPRV 324
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  354 MAMIHIKRcTPIPALLFTCISTLLMLVTS-----DMYT-LINYVGFINYLFYGVTVAGQIVLRWKKPDILRPIKVNL-IF 426
Cdd:TIGR01773 325 FMKLNKKG-VPVQAVLASTFFSFLTVVVNyfapdKVFLfLVNSSGAIALLVYLVIAVSQLRMRKKLKANGEAIKIRMwLY 403
                         410       420       430
                  ....*....|....*....|....*....|....
gi 148233624  427 PVIYLLFWAFlLVFSLWSEPVVCGIGLAIMLTGV 460
Cdd:TIGR01773 404 PWLTWLVIIF-ICGILVSMLFIPSMRDEVLLTGL 436
put_Glu_GABA_T TIGR03813
putative glutamate/gamma-aminobutyrate antiporter; Members of this protein family are putative ...
90-461 1.76e-08

putative glutamate/gamma-aminobutyrate antiporter; Members of this protein family are putative putative glutamate/gamma-aminobutyrate antiporters. Each member of the seed alignment is found adjacent to a glutamate decarboxylase, which converts glutamate (Glu) to gamma-aminobutyrate (GABA). However, the majority belong to genome contexts with a glutaminase (converts Gln to Glu) as well as the decarboxylase that converts Glu to GABA. The specificity of the transporter remains uncertain.


Pssm-ID: 163525 [Multi-domain]  Cd Length: 474  Bit Score: 55.60  E-value: 1.76e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   90 ALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLR---LWIAVLVIYPTnqaviALTFSNYVLQPLFPTCFAPES------G 160
Cdd:TIGR03813  48 SLVAAELATAWPEKGGVFRWVGEAFGARWGFLAifmLWAQVTIWFPT-----VLTFGAVSLAFIGPEATVDESlagnklY 122
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  161 LRLLAAVCLLLLTWVNCASVRWATRVQDIF-TAGKLLALGLIIIMGIVQICKG-----EYFWLEPKNAFENFQepDIGLI 234
Cdd:TIGR03813 123 VLVSVLFVYWLATFIALRGVAAFTKVAKWGgIVGTIIPAAILVILGISYLLTGgesqiPLRWDDAFPDFTNFD--NVVLA 200
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  235 ALAFLqgsfAYGGWNFLNYVTEELVNPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKL---- 310
Cdd:TIGR03813 201 ASIFL----FYAGMEMNAVHVKDVDNPDKNYPIAILIAALGTVLIFVLGTLAIAFIIPREDISLTQSLLVAFDNAFhwag 276
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  311 LGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSLMAMIH----IKRCTPIPALLFTCISTLLMLVTS--DM 384
Cdd:TIGR03813 277 LSWLGPILAFALAIGVLAGVVTWVAGPSSGMLAVAKAGYLPTFFQKTNkngmPIHIMFVQGIAVSVLSVLFVVMPSvqAA 356
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 148233624  385 YTLINYVGFINYL-FYGVTVAGQIVLRWKKPDILRPIKVnlifPVIYLLFWafllvfsLWSEPVVCGIGLAIMLTGVP 461
Cdd:TIGR03813 357 FQILSQLTVILYLvMYLLMFASAIYLRYSQPDRPRPYRI----PGGLAGMW-------FIGGLGFVGSALAFVLSFIP 423
PRK11049 PRK11049
D-alanine/D-serine/glycine permease; Provisional
243-439 1.59e-07

D-alanine/D-serine/glycine permease; Provisional


Pssm-ID: 236830 [Multi-domain]  Cd Length: 469  Bit Score: 52.43  E-value: 1.59e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 243 FAYGGWNFLNYVTEELVNPYKNLPRAI-FISIPLVTFvYVFANIAYVTAMSPQELLASNAVAVT-FGEKLLGVMAWIMPI 320
Cdd:PRK11049 222 FAFVGIELVGTTAAETKDPEKSLPRAInSIPIRIIMF-YVFALIVIMSVTPWSSVVPDKSPFVElFVLVGLPAAASVINF 300
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 321 SVALSTFGGVNGSLFTSSRLFFAGAREGHLPSLMAMIHiKRCTPIPALLFTCI----STLLMLVTSDM---YTLINYVGF 393
Cdd:PRK11049 301 VVLTSAASSANSGVFSTSRMLFGLAQEGVAPKAFAKLS-KRAVPAKGLTFSCIcllgGVVLLYVNPSVigaFTLVTTVSA 379
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|.
gi 148233624 394 INYLF-YGVTVAGQIVLRWKKPDILRPIKVNLIFPVIY----LLFWAFLLV 439
Cdd:PRK11049 380 ILFMFvWTIILCSYLVYRKQRPHLHEKSIYKMPLGKLMcwvcMAFFAFVLV 430
arg_ornith_anti TIGR03810
arginine-ornithine antiporter; Members of this protein family are the arginine/ornithine ...
38-207 1.62e-07

arginine-ornithine antiporter; Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2 [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 163522 [Multi-domain]  Cd Length: 468  Bit Score: 52.36  E-value: 1.62e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   38 KEIGLVSACGIIVGNIIGSGIFVSPKGvMENAGSVGMALIVWIVTGVITAVGALCYAELGVTIPK-SGGDYSYVKDIFGG 116
Cdd:TIGR03810   1 KKLGLGALTALVVGSMIGSGIFSLPSD-MAAGAAAGAVLIGWVITGVGMLALAFSFQNLANKKPElDGGVYSYAKAGFGP 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  117 LAGFLRLWIAVLVIYPTNQAVIALTFSNyvLQPLFPtcfAPESGLRLLAAVCLLLLTW-----VNcASVRWATRVQDIFT 191
Cdd:TIGR03810  80 FMGFISAWGYWLSAWLGNVAYATLLFST--LGYFFP---IFGGGNNPPSIIGASVLLWcvhflVL-RGVEGAAFINTITT 153
                         170
                  ....*....|....*.
gi 148233624  192 AGKLLALGLIIIMGIV 207
Cdd:TIGR03810 154 IAKLVPLFVFIVIGIF 169
PRK10238 PRK10238
aromatic amino acid transporter; Provisional
48-465 4.60e-07

aromatic amino acid transporter; Provisional


Pssm-ID: 182324 [Multi-domain]  Cd Length: 456  Bit Score: 50.72  E-value: 4.60e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  48 IIVGNIIGSGIFVSPKGVMENAGS---VGMALIVWIVTGVITAVGalcyaELGVTIPKSGGDYSYVKDIFGGLAGFLRLW 124
Cdd:PRK10238  22 IALGGAIGTGLFLGSASVIQSAGPgiiLGYAIAGFIAFLIMRQLG-----EMVVEEPVAGSFSHFAYKYWGSFAGFASGW 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 125 ----IAVLViyptnqAVIALTFSNYVLQPLFptcfaPESGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAGKLLALGL 200
Cdd:PRK10238  97 nywvLYVLV------AMAELTAVGKYIQFWY-----PEIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIAVVA 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 201 IIIMGIVQICKGEYfwlEPKNAFENFQEPD----IGLIALAFLQG--SFAYGGWNFLNYVTEELVNPYKNLPRAIFISIP 274
Cdd:PRK10238 166 MIIFGGWLLFSGNG---GPQATVSNLWDQGgflpHGFTGLVMMMAiiMFSFGGLELVGITAAEADNPEQSIPKATNQVIY 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 275 LVTFVYVfANIAYVTAMSPQELLASNAVAVT-----FGEKLLGVMAWIMPISVALSTFggvNGSLFTSSRLFFAGAREGH 349
Cdd:PRK10238 243 RILIFYI-GSLAVLLSLMPWTRVTADTSPFVlifheLGDTFVANALNIVVLTAALSVY---NSCVYCNSRMLFGLAQQGN 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 350 LPSLMAMIHiKRCTPIPALLFTCISTLLMLvtsdmytLINYVG----------------FINYLFygVTVAGQIVLRWKK 413
Cdd:PRK10238 319 APKALASVD-KRGVPVNTILVSALVTALCV-------LINYLApesafgllmalvvsalVINWAM--ISLAHMKFRRAKQ 388
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 148233624 414 PDILRPIKVNLIFPV---IYLLFWAFLLVFSLWSEpvvcgiGLAIMLTGVPVYFL 465
Cdd:PRK10238 389 EQGVVTRFPALLYPLgnwICLLFMAAVLVIMLMTP------GMAISVYLIPVWLI 437
ureacarb_perm TIGR03428
permease, urea carboxylase system; A number of bacteria obtain nitrogen by biotin- and ...
79-412 1.50e-06

permease, urea carboxylase system; A number of bacteria obtain nitrogen by biotin- and ATP-dependent urea degradation system distinct from urease. The two characterized proteins of this system are the enzymes urea carboxylase and allophanate hydrolase, but other, uncharacterized proteins co-occur as genes encoded nearby in multiple organisms. This family includes predicted permeases of the amino acid permease family, likely to transport either urea or a compound from which urea is derived. It is found so far only Actinobacteria, whereas a number of other species with the urea carboxylase have an adjacent ABC transporter operon.


Pssm-ID: 132469 [Multi-domain]  Cd Length: 475  Bit Score: 49.45  E-value: 1.50e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624   79 WIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLV-IYPTNQAVIALT------FSNYVLQPLF 151
Cdd:TIGR03428  53 WPVVFVGQLLVALNFAELAARYPISGAIYQWSRRMGGEVIGWFAGWFMIIAqIVTAAAAAIALQvvlpniWSGFQIIGED 132
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  152 PTCFAPESGLRLLA--AVCLLLLTWVNCASVRWATRVQDIFTAGKLLALGLIIIMGIVQICKGeyfwlePKNAFENFQEP 229
Cdd:TIGR03428 133 PTLTSPSGAANAVLlgSVLLVLTTVINCIGVEWMSRVNTIGVTCEIVGVLAVIGVLFTHAQRG------PGVVFDTSVTG 206
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  230 D----IGLIALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQE--LLASNAVA 303
Cdd:TIGR03428 207 AspgyYGAFLVSGLMAAYVMVGFGSAGELSEETKNPRRVAPRTILTALSVSALGGGLMILGALMAAPSLTdgRLAAEGLP 286
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  304 VTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPS--LMAMIHIKRCTPI-PALLFTCISTLLMLV 380
Cdd:TIGR03428 287 YVLSAVLDSPWGTVLLVDVAIAILVCTLAIQTAGSRLMFSMARDGKLPAsaQLSRVHPRTGTPIlPSIVIGVLCIGILLI 366
                         330       340       350
                  ....*....|....*....|....*....|....*.
gi 148233624  381 ---TSDMYTLINYVGFIN-YLFYGVTVAGQIVLRWK 412
Cdd:TIGR03428 367 nvgNSALFATLASVCIVLiYLAYLLVTVPLLLRRLR 402
PRK10249 PRK10249
phenylalanine transporter; Provisional
48-391 4.47e-06

phenylalanine transporter; Provisional


Pssm-ID: 236667 [Multi-domain]  Cd Length: 458  Bit Score: 47.67  E-value: 4.47e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  48 IIVGNIIGSGIFVSPKGVMENAGSVgmALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAV 127
Cdd:PRK10249  31 IALGGAIGTGLFLGIGPAIQMAGPA--VLLGYGVAGIIAFLIMRQLGEMVVEEPVSGSFAHFAYKYWGPFAGFLSGWNYW 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 128 LVIYPTNQAviALTFSNYVLQPLFPtcfapESGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAGKLLALGLIIIMGIV 207
Cdd:PRK10249 109 VMFVLVGMA--ELTAAGIYMQYWFP-----DVPTWIWAAAFFIIINAVNLVNVRLYGETEFWFALIKVLAIIGMIGFGLW 181
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 208 QICKGEYfwlEPKNAFEN-------FQEPDIGLI-ALAFLQgsFAYGGWNFLNYVTEELVNPYKNLPRAIFISIPLVTFV 279
Cdd:PRK10249 182 LLFSGHG---GEKASIDNlwryggfFATGWNGLIlSLAVIM--FSFGGLELIGITAAEARDPEKSIPKAVNQVVYRILLF 256
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 280 YVfANIAYVTAMSPQELLASNA--VAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSLMAMI 357
Cdd:PRK10249 257 YI-GSLVVLLALYPWVEVKSNSspFVMIFHNLDSNVVASALNFVILVASLSVYNSGVYSNSRMLFGLSVQGNAPKFLTRV 335
                        330       340       350
                 ....*....|....*....|....*....|....
gi 148233624 358 HiKRCTPIPALLFTCISTLLMLvtsdmytLINYV 391
Cdd:PRK10249 336 S-RRGVPINSLMLSGAITSLVV-------LINYL 361
PRK10197 PRK10197
gamma-aminobutyrate transporter; Provisional
50-410 5.16e-06

gamma-aminobutyrate transporter; Provisional


Pssm-ID: 182297 [Multi-domain]  Cd Length: 446  Bit Score: 47.69  E-value: 5.16e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  50 VGNIIGSGIFVSPKGVMENAGSVgmALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGF----LRLWI 125
Cdd:PRK10197   4 IAGVIGASLFVGSSVAIAEAGPA--VLLAYLFAGLLVVMIMRMLAEMAVATPDTGSFSTYADKAIGRWAGYtigwLYWWF 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 126 AVLVIyPTNQAVIALTFSNYVlqplfptcfaPESGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAGKLLALGLIIIMG 205
Cdd:PRK10197  82 WVLVI-PLEANIAAMILHSWV----------PGIPIWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAILAFIFLG 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 206 IVQIcKGEYFWLEPKNAFE-----NFQEPDIGLIALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFISIPLVTFVY 280
Cdd:PRK10197 151 AVAI-SGFYPYAEVSGISRlwdsgGFMPNGFGAVLSAMLITMFSFMGAEIVTIAAAESDTPEKHIVRATNSVIWRISIFY 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 281 VfANIAYVTAMSPQELLASNAVAVTFGE-KLLGV--MAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSLMAMI 357
Cdd:PRK10197 230 L-CSIFVVVALIPWNMPGLKAVGSYRSVlELLNIphAKLIMDCVILLSVTSCLNSALYTASRMLYSLSRRGDAPAVMGKI 308
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 148233624 358 HIKRcTPIPALLFTCISTLLMLVTSDMYT------LINYVGFINYLFYGVTVAGQIVLR 410
Cdd:PRK10197 309 NRSK-TPYVAVLLSTGAAFLTVVVNYYAPakvfkfLIDSSGAIALLVYLVIAVSQLRMR 366
proY PRK10580
putative proline-specific permease; Provisional
48-377 8.09e-06

putative proline-specific permease; Provisional


Pssm-ID: 182566 [Multi-domain]  Cd Length: 457  Bit Score: 46.74  E-value: 8.09e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  48 IIVGNIIGSGIFVSPKGVMENAGSvgMALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAV 127
Cdd:PRK10580  19 MALGSAIGTGLFYGSADAIKMAGP--SVLLAYIIGGVAAYIIMRALGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYC 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 128 LVIyptnqavIALTFSNYVLQPLFPTCFAPESGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAGKLLALGLIIIMGIV 207
Cdd:PRK10580  97 FEI-------LIVAIADVTAFGIYMGVWFPTVPHWIWVLSVVLIICAVNLMSVKVFGELEFWFSFFKVATIIIMIVAGIG 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 208 QICKGEYFWLEP---KNAFEN---FQEPDIGLIaLAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFiSIPLVTFVYV 281
Cdd:PRK10580 170 IIIWGIGNGGQPtgiHNLWSNggfFSNGWLGMV-MSLQMVMFAYGGIEIIGITAGEAKDPEKSIPRAIN-SVPMRILVFY 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 282 FANIAYVTAMSPQELLASNA--VAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSLMAMIHi 359
Cdd:PRK10580 248 VGTLFVIMSIYPWNQVGTNGspFVLTFQHMGITFAASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKIFSKTS- 326
                        330
                 ....*....|....*...
gi 148233624 360 KRCTPIPALLFTCISTLL 377
Cdd:PRK10580 327 RRGIPWVTVLVMTTALLF 344
PRK11387 PRK11387
S-methylmethionine transporter; Provisional
50-382 1.62e-05

S-methylmethionine transporter; Provisional


Pssm-ID: 236904 [Multi-domain]  Cd Length: 471  Bit Score: 46.00  E-value: 1.62e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  50 VGNIIGSGIFVSPKGVMENAGSVGM-------ALIVWIVTgvitavgaLCYAELGVTIPKSGGDYSYVKDIFGGLAGFLR 122
Cdd:PRK11387  26 LGGVIGTGLFFNTGYIISTTGAAGTllayligALVVYLVM--------QCLGELSVAMPETGAFHVYAARYLGPATGYTV 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 123 LWIAVLVIypTNQAVIALTFSNYVLQPLFptcfaPESGLRLLAAVCLLLLTWVNCASVRWATRVQDIFTAGKLLALGLII 202
Cdd:PRK11387  98 AWLYWLTW--TVALGSSLTAAGFCMQYWF-----PQVPVWPWCLLFCALIFGLNVVSTRFFAEGEFWFSLIKVVTILAFI 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 203 IMGIVQIckgeYFWL-----EPKNAFENFQE----PDIGL-IALAFLQGSFAYGGWNFLNYVTEELVNPYKNLPRAIFIS 272
Cdd:PRK11387 171 VLGGAAI----FGFIpmqdgSPAPGLRNLTAegwfPHGGLpILMTMVAVNFAFSGTELIGIAAGETENPAKVIPVAIRTT 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 273 IPLVTFVYVfANIAYVTAMSPQELLASNAVAVTFGEKLLGV--MAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHL 350
Cdd:PRK11387 247 IARLVIFFV-GTVLVLAALIPMQQAGVEKSPFVLVFEKVGIpyAADIFNFVILTAILSAANSGLYASGRMLWSLSNEGTL 325
                        330       340       350
                 ....*....|....*....|....*....|..
gi 148233624 351 PSLMAMIHiKRCTPIPALLFTCISTLLMLVTS 382
Cdd:PRK11387 326 PACFARLT-KRGIPLTALSVSMLGGLLALFSS 356
PRK15049 PRK15049
L-asparagine permease; Provisional
48-355 1.75e-05

L-asparagine permease; Provisional


Pssm-ID: 185009 [Multi-domain]  Cd Length: 499  Bit Score: 45.77  E-value: 1.75e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  48 IIVGNIIGSGIFVSPKGVMENAGSvGMALiVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWiav 127
Cdd:PRK15049  38 IAIGGAIGTGLFLGAGARLQMAGP-ALAL-VYLICGLFSFFILRALGELVLHRPSSGSFVSYAREFLGEKAAYVAGW--- 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 128 lvIYPTNQAVIALT-FSNYVLQPLFPTCFAPESGLRLLAAVCLLLLTwVNCASVRWATRVQDIFTAGKLLALGLIIIMGI 206
Cdd:PRK15049 113 --MYFINWAMTGIVdITAVALYMHYWGAFGGVPQWVFALAALTIVGT-MNMIGVKWFAEMEFWFALIKVLAIVTFLVVGT 189
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 207 VQICKGE--------YFWLEPKNAFenfqEPDIGLIALAFLQG-SFAYGGWNFLNYVTEELVNPYKNLPRAIFISIPLVT 277
Cdd:PRK15049 190 VFLGSGQpldgnttgFHLITDNGGF----FPHGLLPALVLIQGvVFAFASIEMVGTAAGECKDPQTMVPKAINSVIWRIG 265
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 148233624 278 FVYVFANIAYVTAMSPQELLASNAVAVTFGEKL-LGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSLMA 355
Cdd:PRK15049 266 LFYVGSVVLLVMLLPWSAYQAGQSPFVTFFSKLgVPYIGSIMNIVVLTAALSSLNSGLYCTGRILRSMAMGGSAPSFMA 344
cadB PRK10435
lysine/cadaverine antiporter; Provisional
38-327 1.11e-04

lysine/cadaverine antiporter; Provisional


Pssm-ID: 182458 [Multi-domain]  Cd Length: 435  Bit Score: 43.20  E-value: 1.11e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  38 KEIGLVSACGIIVGNIIGSGIFVSPKgvmeNAGSVG-MALIVWIvtgvITAVGAL----CYAELGVTIPKSGGDYSY--- 109
Cdd:PRK10435   5 KKIGLFACTGVVAGNMMGSGIALLPA----NLASIGsIAIWGWI----ISIIGAMslayVYARLATKNPQQGGPIAYage 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 110 VKDIFGGLAGFLRL---WIAVLviyptnqaVIALTFSNYvLQPLFPTCFAPESGlRLLAAVCLLLLTWVNCASVRWATRv 186
Cdd:PRK10435  77 ISPAFGFQTGVLYYhanWIGNL--------AIGITAVSY-LSTFFPVLNDPIPA-GIACIAIVWVFTFVNMLGGTWVSR- 145
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 187 qdiftagkLLALGLIIIM-GIVQICKGEYFWLEPKNAFENFQEP---DIGLIALAFLQGSFAYGGWNFLNYVTEELVNPY 262
Cdd:PRK10435 146 --------LTTIGLVLVLiPVVGTAIVGWHWFDAATYAANWNTSdttDGHAIIKSILLCLWAFVGVESAAVSTGMVKNPK 217
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 148233624 263 KNLPRAIFISIPLVTFVYVFANIAyVTAMSP-QELLASNAVAVTFGEKLLGvmAWIMPISVALSTF 327
Cdd:PRK10435 218 RTVPLATMLGTGLAGIIYIAATQV-ISGMFPaSVMAASGAPFAISASTILG--NWAAPLVSAFTAF 280
PRK10836 PRK10836
lysine transporter; Provisional
35-382 4.67e-03

lysine transporter; Provisional


Pssm-ID: 182767 [Multi-domain]  Cd Length: 489  Bit Score: 38.26  E-value: 4.67e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624  35 ALKKEIGLVSACGIIVGNIIGSGIFVSPKGVMENAGSvGMALIVWIVTGVITAVGALCYAELGVTIPKSGG----DYSYV 110
Cdd:PRK10836  12 GLRRELKARHLTMIAIGGSIGTGLFVASGATISQAGP-GGALLSYMLIGLMVYFLMTSLGELAAYMPVSGSfatyGQNYV 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 111 KDIFGGLAGFlrlwiavlvIYPTNQAV-IALtfsNYVLQPLFPTCFAPESGLRLLAAVCLLLLTWVNCASVRWATRVQDI 189
Cdd:PRK10836  91 EEGFGFALGW---------NYWYNWAVtIAV---DLVAAQLVMSWWFPDTPGWIWSALFLGVIFLLNYISVRGFGEAEYW 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 190 FTAGKLLALGLIIIMG---IVQICKGEyfwlEPKnAFENFQEPDI-------GLIALAFLQGsFAYGGWNFLNYVTEELV 259
Cdd:PRK10836 159 FSLIKVTTVIVFIIVGvlmIIGIFKGA----EPA-GWSNWTIGDApfaggfaAMIGVAMIVG-FSFQGTELIGIAAGESE 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233624 260 NPYKNLPRAIFISIPLVTFVYVFA--NIAYVTAMSPQELLASNAVAVT-------FGEKLLGVMAWIMPISVALSTFGGV 330
Cdd:PRK10836 233 DPAKNIPRAVRQVFWRILLFYVFAilIISLIIPYTDPSLLRNDVKDISvspftlvFQHAGLLSAAAVMNAVILTAVLSAG 312
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|..
gi 148233624 331 NGSLFTSSRLFFAGAREGHLPSLMAMIHiKRCTPIPALLFTCISTLLMLVTS 382
Cdd:PRK10836 313 NSGMYASTRMLYTLACDGKAPRIFAKLS-RGGVPRNALYATTVIAGLCFLTS 363
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH