NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148233366|ref|NP_001079707.1|]
View 

endothelin receptor B subtype 2 precursor

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
113-372 6.66e-32

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


:

Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 122.03  E-value: 6.66e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366  113 IIYKNKCMRNGPNVLIASLALGDLFYILIAIPIHIYKLLAEHWPFGVHICKLVPFIQKATVGVTVLSLCALSIDRYRAVA 192
Cdd:pfam00001   2 VILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366  193 SWNRIRGIGIPVRKAIELTLIWAVAIILAVPEAIAFNLVELDFRGQTilVCMLPMEQTSDFMRFYQEVkvwWLFGFYFCL 272
Cdd:pfam00001  82 HPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLFSWLRTVEEGNVT--TCLIDFPEESTLRSYTLLS---TLLGFVLPL 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366  273 PLACtgVFYTLMSCEMLSIKNGMRIALNDHMKQRRE--VAKTVFCLVVIFALCWLPLHVSSILkktvYDGRDPNRCELLS 350
Cdd:pfam00001 157 LVIL--VCYTLILRTLRKRARSGASQARAKRSSSKErkAAKMLLVVVVVFVLCWLPYHIVLLL----DSLCPLSIIRLLP 230
                         250       260
                  ....*....|....*....|..
gi 148233366  351 FFMvmnYIGINMASLNSCINPV 372
Cdd:pfam00001 231 TAL---LITLWLAYVNSCLNPI 249
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
113-372 6.66e-32

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 122.03  E-value: 6.66e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366  113 IIYKNKCMRNGPNVLIASLALGDLFYILIAIPIHIYKLLAEHWPFGVHICKLVPFIQKATVGVTVLSLCALSIDRYRAVA 192
Cdd:pfam00001   2 VILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366  193 SWNRIRGIGIPVRKAIELTLIWAVAIILAVPEAIAFNLVELDFRGQTilVCMLPMEQTSDFMRFYQEVkvwWLFGFYFCL 272
Cdd:pfam00001  82 HPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLFSWLRTVEEGNVT--TCLIDFPEESTLRSYTLLS---TLLGFVLPL 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366  273 PLACtgVFYTLMSCEMLSIKNGMRIALNDHMKQRRE--VAKTVFCLVVIFALCWLPLHVSSILkktvYDGRDPNRCELLS 350
Cdd:pfam00001 157 LVIL--VCYTLILRTLRKRARSGASQARAKRSSSKErkAAKMLLVVVVVFVLCWLPYHIVLLL----DSLCPLSIIRLLP 230
                         250       260
                  ....*....|....*....|..
gi 148233366  351 FFMvmnYIGINMASLNSCINPV 372
Cdd:pfam00001 231 TAL---LITLWLAYVNSCLNPI 249
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
93-381 6.81e-17

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 80.21  E-value: 6.81e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366  93 TILSCVIFLVGIVGNSTLLRIIYKNKcMRNGPNVLIASLALGDLFYILIaIPIHIYKLLAEHWPFGVHICKLVPFIQKAT 172
Cdd:PHA03087  44 IVVYSTIFFFGLVGNIIVIYVLTKTK-IKTPMDIYLLNLAVSDLLFVMT-LPFQIYYYILFQWSFGEFACKIVSGLYYIG 121
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366 173 VGVTVLSLCALSIDRYRAVASWNRIRGIGIPVRKAIELTLIWAVAIILAVPEAIAFNlVELDFRgqtILVCmlpmeqtsd 252
Cdd:PHA03087 122 FYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYT-TKKDHE---TLIC--------- 188
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366 253 FMRFYQEVKVWWLF------GFYFCLPLACTGVFYTLMSCEMLSIKNGmrialndhmKQRREVAKTVFCLVVIFALCWLP 326
Cdd:PHA03087 189 CMFYNNKTMNWKLFinfeinIIGMLIPLTILLYCYSKILITLKGINKS---------KKNKKAIKLVLIIVILFVIFWLP 259
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 148233366 327 LHVSSILkKTVYDGRDPNRCELLSFFMVMNYIGINMASLNSCINPVALYFVSRKF 381
Cdd:PHA03087 260 FNVSVFV-YSLHILHFKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFF 313
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
113-372 6.66e-32

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 122.03  E-value: 6.66e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366  113 IIYKNKCMRNGPNVLIASLALGDLFYILIAIPIHIYKLLAEHWPFGVHICKLVPFIQKATVGVTVLSLCALSIDRYRAVA 192
Cdd:pfam00001   2 VILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366  193 SWNRIRGIGIPVRKAIELTLIWAVAIILAVPEAIAFNLVELDFRGQTilVCMLPMEQTSDFMRFYQEVkvwWLFGFYFCL 272
Cdd:pfam00001  82 HPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLFSWLRTVEEGNVT--TCLIDFPEESTLRSYTLLS---TLLGFVLPL 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366  273 PLACtgVFYTLMSCEMLSIKNGMRIALNDHMKQRRE--VAKTVFCLVVIFALCWLPLHVSSILkktvYDGRDPNRCELLS 350
Cdd:pfam00001 157 LVIL--VCYTLILRTLRKRARSGASQARAKRSSSKErkAAKMLLVVVVVFVLCWLPYHIVLLL----DSLCPLSIIRLLP 230
                         250       260
                  ....*....|....*....|..
gi 148233366  351 FFMvmnYIGINMASLNSCINPV 372
Cdd:pfam00001 231 TAL---LITLWLAYVNSCLNPI 249
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
93-381 6.81e-17

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 80.21  E-value: 6.81e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366  93 TILSCVIFLVGIVGNSTLLRIIYKNKcMRNGPNVLIASLALGDLFYILIaIPIHIYKLLAEHWPFGVHICKLVPFIQKAT 172
Cdd:PHA03087  44 IVVYSTIFFFGLVGNIIVIYVLTKTK-IKTPMDIYLLNLAVSDLLFVMT-LPFQIYYYILFQWSFGEFACKIVSGLYYIG 121
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366 173 VGVTVLSLCALSIDRYRAVASWNRIRGIGIPVRKAIELTLIWAVAIILAVPEAIAFNlVELDFRgqtILVCmlpmeqtsd 252
Cdd:PHA03087 122 FYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYT-TKKDHE---TLIC--------- 188
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366 253 FMRFYQEVKVWWLF------GFYFCLPLACTGVFYTLMSCEMLSIKNGmrialndhmKQRREVAKTVFCLVVIFALCWLP 326
Cdd:PHA03087 189 CMFYNNKTMNWKLFinfeinIIGMLIPLTILLYCYSKILITLKGINKS---------KKNKKAIKLVLIIVILFVIFWLP 259
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 148233366 327 LHVSSILkKTVYDGRDPNRCELLSFFMVMNYIGINMASLNSCINPVALYFVSRKF 381
Cdd:PHA03087 260 FNVSVFV-YSLHILHFKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFF 313
PHA02638 PHA02638
CC chemokine receptor-like protein; Provisional
94-382 9.22e-09

CC chemokine receptor-like protein; Provisional


Pssm-ID: 165021 [Multi-domain]  Cd Length: 417  Bit Score: 55.79  E-value: 9.22e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366  94 ILSCVIFLVGIVGNSTLLRIIYKNKcMRNGPNVLIASLALGDLFYIlIAIPIHIYKLLaEHWPFGVHICKLVPFIQKATV 173
Cdd:PHA02638 103 IFYIIIFILGLFGNAAIIMILFCKK-IKTITDIYIFNLAISDLIFV-IDFPFIIYNEF-DQWIFGDFMCKVISASYYIGF 179
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366 174 GVTVLSLCALSIDRYRAV---ASWNRIRGIGIpvrkAIELTLI-WAVAIILAVPEAIAFNLVELDFRGQ----TI--LVC 243
Cdd:PHA02638 180 FSNMFLITLMSIDRYFAIlypISFQKYRTFNI----GIILCIIsWILSLIITSPAYFIFEASNIIFSAQdsneTIsnYQC 255
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366 244 MLPMEQTSDFMRFYQEVKVWWLFGFYFCLPLACTGVFYtlmscemlsikngMRIALNdhMKQRREVAKT-----VFCLVV 318
Cdd:PHA02638 256 TLIEDNEKNNISFLGRILQFEINILGMFIPIIIFAFCY-------------IKIILK--LKQLKKSKKTksiiiVSIIII 320
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 148233366 319 IFALCWLPLHVsSILKKTVYDGRDPNR--CELLSFFMVMNY---IGINMASLNSCINPVALYFVSRKFK 382
Cdd:PHA02638 321 CSLICWIPLNI-VILFATMYSFKGFNSiiSEHICGFIKLGYammLAEAISLTHCCINPLIYTLIGENFR 388
PHA02834 PHA02834
chemokine receptor-like protein; Provisional
90-390 8.00e-08

chemokine receptor-like protein; Provisional


Pssm-ID: 165177 [Multi-domain]  Cd Length: 323  Bit Score: 52.21  E-value: 8.00e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366  90 YVTTILSCVIFLVGIVGNSTLLRIIYKNKCMRNgPNVLIASLALGDLFyILIAIPIHIYKLLAEhWPFGVHICKLVPFIQ 169
Cdd:PHA02834  29 YFVIVFYILLFIFGLIGNVLVIAVLIVKRFMFV-VDVYLFNIAMSDLM-LVFSFPFIIHNDLNE-WIFGEFMCKLVLGVY 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366 170 KATVGVTVLSLCALSIDRYRAVASWNRIRGIGIPVRKAIELTlIWAVAIILAVPEAIAFNLVELDFRGQTILVCMLPMEQ 249
Cdd:PHA02834 106 FVGFFSNMFFVTLISIDRYILVVNATKIKNKSISLSVLLSVA-AWVCSVILSMPAMVLYYVDNTDNLKQCIFNDYHENFS 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148233366 250 TSDFMRFyqEVKVwwlfgFYFCLPLACTGVFYTLMSCEMLSIKNgmrialndhmKQRREVAKTVFCLVVIFALCWLPLHV 329
Cdd:PHA02834 185 WSAFFNF--EINI-----FGIVIPLIILIYCYSKILYTLKNCKN----------KNKTRSIKIILTVVTFTVVFWVPFNI 247
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 148233366 330 SSILKKTVYDGRDPNRCELLSFFMVMNYIGINMASLNSCINPVALYFVSRKFKNCFQSCLC 390
Cdd:PHA02834 248 VLFINSLQSVGLIDIGCYHFKKIVYSIDIAELISFVHCCVNPIIYAFVGKNFKKVFKNMFC 308
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH