NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148232672|ref|NP_001080623.1|]
View 

synuclein, alpha (non A4 component of amyloid precursor)

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Synuclein pfam01387
Synuclein; There are three types of synucleins in humans, these are called alpha, beta and ...
1-133 5.69e-44

Synuclein; There are three types of synucleins in humans, these are called alpha, beta and gamma. Alpha synuclein has been found mutated in families with autosomal dominant Parkinson's disease. A peptide of alpha synuclein has also been found in amyloid plaques in Alzheimer's patients.


:

Pssm-ID: 250579  Cd Length: 132  Bit Score: 142.83  E-value: 5.69e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148232672    1 MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVSNVGGAVVTGVTAVAHK 80
Cdd:pfam01387   1 MDVFMKGLSKAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTKEGVVQGVATVAEKTKEQANNVGGAVVSGVNTVAQK 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 148232672   81 TVEGAGNFAAATGLVKKDQ--KNESGFGPEGTmenSENMPVNPNNETYEMPPEEE 133
Cdd:pfam01387  81 TVEGAGNIAAATGVVKKDElgKNEEEAPQEGI---EEDKPVEPDNEAYEMPSEEG 132
 
Name Accession Description Interval E-value
Synuclein pfam01387
Synuclein; There are three types of synucleins in humans, these are called alpha, beta and ...
1-133 5.69e-44

Synuclein; There are three types of synucleins in humans, these are called alpha, beta and gamma. Alpha synuclein has been found mutated in families with autosomal dominant Parkinson's disease. A peptide of alpha synuclein has also been found in amyloid plaques in Alzheimer's patients.


Pssm-ID: 250579  Cd Length: 132  Bit Score: 142.83  E-value: 5.69e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148232672    1 MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVSNVGGAVVTGVTAVAHK 80
Cdd:pfam01387   1 MDVFMKGLSKAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTKEGVVQGVATVAEKTKEQANNVGGAVVSGVNTVAQK 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 148232672   81 TVEGAGNFAAATGLVKKDQ--KNESGFGPEGTmenSENMPVNPNNETYEMPPEEE 133
Cdd:pfam01387  81 TVEGAGNIAAATGVVKKDElgKNEEEAPQEGI---EEDKPVEPDNEAYEMPSEEG 132
 
Name Accession Description Interval E-value
Synuclein pfam01387
Synuclein; There are three types of synucleins in humans, these are called alpha, beta and ...
1-133 5.69e-44

Synuclein; There are three types of synucleins in humans, these are called alpha, beta and gamma. Alpha synuclein has been found mutated in families with autosomal dominant Parkinson's disease. A peptide of alpha synuclein has also been found in amyloid plaques in Alzheimer's patients.


Pssm-ID: 250579  Cd Length: 132  Bit Score: 142.83  E-value: 5.69e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148232672    1 MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVSNVGGAVVTGVTAVAHK 80
Cdd:pfam01387   1 MDVFMKGLSKAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTKEGVVQGVATVAEKTKEQANNVGGAVVSGVNTVAQK 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 148232672   81 TVEGAGNFAAATGLVKKDQ--KNESGFGPEGTmenSENMPVNPNNETYEMPPEEE 133
Cdd:pfam01387  81 TVEGAGNIAAATGVVKKDElgKNEEEAPQEGI---EEDKPVEPDNEAYEMPSEEG 132
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH