NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148223267|ref|NP_001087663.1|]
View 

solute carrier family 22 member 6-B

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
139-508 8.82e-29

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


:

Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 116.26  E-value: 8.82e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 139 AQSIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPT 218
Cdd:cd06174   39 IVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLLLAFASSLWLLLVGRFLLGLGGGALYPAAAALIAEWFPP 118
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 219 GNRAFTSTATGYCYTMGQLVLVGLAFIIRD---WQWLQLAASIPFFFYFLYSWWIPesgrwlvlsgkpevackalkkvaq 295
Cdd:cd06174  119 KERGRALGLFSAGFGLGALLGPLLGGLLAEslgWRWLFLILAILGLLLALLLLFLL------------------------ 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 296 ingkkeagekltveilkssmqreinashnstysaldlvrtpvvrRISFCISCTWFSTSFAYYGLALDLQSFGVS------ 369
Cdd:cd06174  175 --------------------------------------------RLLLLLALAFFLLSFGYYGLLTYLPLYLQEvlglsa 210
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 370 --IYIIQIIFGTVDIPAKFISYFITTYVGRRVS-QAITLILAGIAILVNISVPQDFQTVrtAMAVFGKGCLAASFNCLYL 446
Cdd:cd06174  211 aeAGLLLSLFGLGGILGALLGGLLSDRLGRRRLlLLIGLLLAALGLLLLALAPSLALLL--VALLLLGFGLGFAFPALLT 288
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148223267 447 YTGELYPTVIRQTGMGLGAMMARLGGIIAPL--AQMTGDIYHSLPLIIFGCLPILSGIAGCFLP 508
Cdd:cd06174  289 LASELAPPEARGTASGLFNTFGSLGGALGPLlaGLLLDTGGYGGVFLILAALALLAALLLLLLP 352
2A0119 TIGR00898
cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]
11-518 0e+00

cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]


:

Pssm-ID: 273328 [Multi-domain]  Cd Length: 505  Bit Score: 544.23  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267   11 GGMGRYQVIHVVLLSLPVFMLASHNLMQNFTAATPSHHCRINGTyeeTNFTGPW-LRALLPMTPTGEFSKCLRYTTPQYE 89
Cdd:TIGR00898   1 GEFGPFQRRTFLLLALPIALLAFHFVLIVFLGATPEHHCRLPDA---ANLSSRCeLNLTLPRLPDGRPESCLRFMVDQWA 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267   90 L-----LENNLTQSYDDLETEPCLDGWVYDHSEFASTIITQWDLVCNHRRMRQVAQSIYMAGVLVGSILFGGLSDKFGRR 164
Cdd:TIGR00898  78 NpsllgCEPLKLSDLGLAATEPCLDGWEYSYDTFSSTIVTEWDLVCEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRK 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  165 PLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPTGNRAFTSTATGYCYTMGQLVLVGLAF 244
Cdd:TIGR00898 158 KVLLLSTLVTAVSGVLTAFSPNYTVFLVFRLLVGMGIGGIWVQAVVLNTEFLPKKQRAIVGTLIQVFFSLGLVLLPLVAY 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  245 IIRDWQWLQLAASIPFFFYFLYSWWIPESGRWLVLSGKPEVACKALKKVAQINGKkeageKLTVEILKSSMQREINASHN 324
Cdd:TIGR00898 238 FIPDWRWLQLAVSLPTFLFFLLSWFVPESPRWLISQGRIEEALKILQRIAKINGK-----KLPAEVLSLSLEKDLSSSKK 312
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  325 StYSALDLVRTPVVRRISFCISCTWFSTSFAYYGLALDLQSFGVSIYIIQIIFGTVDIPAKFISYFITTYVGRRVSQAIT 404
Cdd:TIGR00898 313 Q-YSFLDLFRTPNLRKTTLCLMMLWFTTAFSYYGLVLDLGNLGGNIYLDLFISGLVELPAKLITLLLIDRLGRRYTMAAS 391
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  405 LILAGIAILVNISVPQDFQTVRTAMAVFGKGCLAASFNCLYLYTGELYPTVIRQTGMGLGAMMARLGGIIAPLAQMTGDI 484
Cdd:TIGR00898 392 LLLAGVALLLLLFVPVDLYFLRTALAVLGKFGITSAFQMVYLYTAELYPTVVRNLGVGVCSTMARVGSIISPFLVYLGEK 471
                         490       500       510
                  ....*....|....*....|....*....|....
gi 148223267  485 YHSLPLIIFGCLPILSGIAGCFLPETLGVPLPET 518
Cdd:TIGR00898 472 WLFLPLVLFGGLALLAGILTLFLPETKGVPLPET 505
 
Name Accession Description Interval E-value
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
139-508 8.82e-29

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 116.26  E-value: 8.82e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 139 AQSIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPT 218
Cdd:cd06174   39 IVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLLLAFASSLWLLLVGRFLLGLGGGALYPAAAALIAEWFPP 118
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 219 GNRAFTSTATGYCYTMGQLVLVGLAFIIRD---WQWLQLAASIPFFFYFLYSWWIPesgrwlvlsgkpevackalkkvaq 295
Cdd:cd06174  119 KERGRALGLFSAGFGLGALLGPLLGGLLAEslgWRWLFLILAILGLLLALLLLFLL------------------------ 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 296 ingkkeagekltveilkssmqreinashnstysaldlvrtpvvrRISFCISCTWFSTSFAYYGLALDLQSFGVS------ 369
Cdd:cd06174  175 --------------------------------------------RLLLLLALAFFLLSFGYYGLLTYLPLYLQEvlglsa 210
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 370 --IYIIQIIFGTVDIPAKFISYFITTYVGRRVS-QAITLILAGIAILVNISVPQDFQTVrtAMAVFGKGCLAASFNCLYL 446
Cdd:cd06174  211 aeAGLLLSLFGLGGILGALLGGLLSDRLGRRRLlLLIGLLLAALGLLLLALAPSLALLL--VALLLLGFGLGFAFPALLT 288
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148223267 447 YTGELYPTVIRQTGMGLGAMMARLGGIIAPL--AQMTGDIYHSLPLIIFGCLPILSGIAGCFLP 508
Cdd:cd06174  289 LASELAPPEARGTASGLFNTFGSLGGALGPLlaGLLLDTGGYGGVFLILAALALLAALLLLLLP 352
2_A_01_02 TIGR00880
Multidrug resistance protein;
141-222 7.96e-05

Multidrug resistance protein;


Pssm-ID: 273318  Cd Length: 141  Bit Score: 41.48  E-value: 7.96e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  141 SIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPTGN 220
Cdd:TIGR00880   5 AGYALGQLIYSPLSGLLTDRFGRKPVLLVGLFIFVLSTAMFALSSNITVLIIARFLQGFGAAFALVAGAALIADIYPPEE 84

                  ..
gi 148223267  221 RA 222
Cdd:TIGR00880  85 RG 86
2A0119 TIGR00898
cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]
11-518 0e+00

cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273328 [Multi-domain]  Cd Length: 505  Bit Score: 544.23  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267   11 GGMGRYQVIHVVLLSLPVFMLASHNLMQNFTAATPSHHCRINGTyeeTNFTGPW-LRALLPMTPTGEFSKCLRYTTPQYE 89
Cdd:TIGR00898   1 GEFGPFQRRTFLLLALPIALLAFHFVLIVFLGATPEHHCRLPDA---ANLSSRCeLNLTLPRLPDGRPESCLRFMVDQWA 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267   90 L-----LENNLTQSYDDLETEPCLDGWVYDHSEFASTIITQWDLVCNHRRMRQVAQSIYMAGVLVGSILFGGLSDKFGRR 164
Cdd:TIGR00898  78 NpsllgCEPLKLSDLGLAATEPCLDGWEYSYDTFSSTIVTEWDLVCEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRK 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  165 PLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPTGNRAFTSTATGYCYTMGQLVLVGLAF 244
Cdd:TIGR00898 158 KVLLLSTLVTAVSGVLTAFSPNYTVFLVFRLLVGMGIGGIWVQAVVLNTEFLPKKQRAIVGTLIQVFFSLGLVLLPLVAY 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  245 IIRDWQWLQLAASIPFFFYFLYSWWIPESGRWLVLSGKPEVACKALKKVAQINGKkeageKLTVEILKSSMQREINASHN 324
Cdd:TIGR00898 238 FIPDWRWLQLAVSLPTFLFFLLSWFVPESPRWLISQGRIEEALKILQRIAKINGK-----KLPAEVLSLSLEKDLSSSKK 312
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  325 StYSALDLVRTPVVRRISFCISCTWFSTSFAYYGLALDLQSFGVSIYIIQIIFGTVDIPAKFISYFITTYVGRRVSQAIT 404
Cdd:TIGR00898 313 Q-YSFLDLFRTPNLRKTTLCLMMLWFTTAFSYYGLVLDLGNLGGNIYLDLFISGLVELPAKLITLLLIDRLGRRYTMAAS 391
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  405 LILAGIAILVNISVPQDFQTVRTAMAVFGKGCLAASFNCLYLYTGELYPTVIRQTGMGLGAMMARLGGIIAPLAQMTGDI 484
Cdd:TIGR00898 392 LLLAGVALLLLLFVPVDLYFLRTALAVLGKFGITSAFQMVYLYTAELYPTVVRNLGVGVCSTMARVGSIISPFLVYLGEK 471
                         490       500       510
                  ....*....|....*....|....*....|....
gi 148223267  485 YHSLPLIIFGCLPILSGIAGCFLPETLGVPLPET 518
Cdd:TIGR00898 472 WLFLPLVLFGGLALLAGILTLFLPETKGVPLPET 505
Sugar_tr pfam00083
Sugar (and other) transporter;
141-517 3.09e-30

Sugar (and other) transporter;


Pssm-ID: 249572 [Multi-domain]  Cd Length: 449  Bit Score: 121.64  E-value: 3.09e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  141 SIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWY--CIFRFLTGVAFSGIVLNSYSLTVEWIPT 218
Cdd:pfam00083  52 SIFSVGCLIGSLFAGKLGDRFGRKPSLLIANVLFVIGALLQGFAPGKSFYmlIVGRVIVGLGVGGISVLVPMYISEIAPK 131
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  219 GNRAFTSTATGYCYTMGQLV--LVGLAFII--RDWQWLQLAAS--IPFFFYFLYSWWIPESGRWLVLSGKPEVACKALKK 292
Cdd:pfam00083 132 KLRGALGSLYQLGITFGILVaaIIGLGLNKysNSDGWRIPLGLqfVPALLLLIGLLFLPESPRWLVLKGKLEEARAVLAK 211
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  293 vaqinGKKEAGEKLTVEILKSSMQREINASHNstySALDLVRTPVVRRISFCISCTWFST------SFAYYGLALdLQSF 366
Cdd:pfam00083 212 -----LRGVSDVDQEIQEIKDSLERSVSEEKA---SWLELFRGKTVRQRLLMGVMLQIFQqltginAIFYYSPTI-FETL 282
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  367 GV--SIYIIQIIFGTVDIPAKFISYFITTYVGRR--------VSQAITLILAGIAILVNISVPQDFqtVRTAMAVFGKGC 436
Cdd:pfam00083 283 GLsdSVLLVTIIVGVVNFVFTFIAIFLVDRFGRRpllllgaaGMAICMLVLGVALLGVNSSKAAGI--VAIVFILLFIAF 360
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  437 LAASFN-CLYLYTGELYPTVIRQTGMGLGAMMARLGGIIAPLA--QMTGDIYHSLPLIIFGCLPILSGIAGCFLPETLGV 513
Cdd:pfam00083 361 FALGWGpVPWVIVSELFPLGVRPKAMAIATAANWLANFLIGFLfpIITGAIGGYVFLVFAGLLVLFILFVFFFVPETKGR 440

                  ....
gi 148223267  514 PLPE 517
Cdd:pfam00083 441 TLEE 444
AraJ COG2814
Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];
141-222 1.33e-07

Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];


Pssm-ID: 225371 [Multi-domain]  Cd Length: 394  Bit Score: 52.62  E-value: 1.33e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 141 SIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPTGN 220
Cdd:COG2814   55 TAYALGVALGAPLLALLTGRLERRRLLLGLLALFIVSNLLSALAPSFAVLLLARALAGLAHGVFWSIAAALAARLVPPGK 134

                 ..
gi 148223267 221 RA 222
Cdd:COG2814  135 RG 136
xylE PRK10077
D-xylose transporter XylE; Provisional
146-306 4.91e-06

D-xylose transporter XylE; Provisional


Pssm-ID: 182225 [Multi-domain]  Cd Length: 479  Bit Score: 47.77  E-value: 4.91e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 146 GVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAF-----------SPNYIW-YCIFRFL--TGVAFSGIVLNSYsl 211
Cdd:PRK10077  67 GCIIGGALGGYCSNRFGRRDSLKIAAVLFFISALGSAWpefgftsigpdNTGYVPeFVIYRIIggIGVGLASMLSPMY-- 144
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 212 TVEWIPTGNRAFTSTATGYCYTMGQLVLVGLAFIIRD-----------WQWLQLAASIPFFFYFLYSWWIPESGRWLVLS 280
Cdd:PRK10077 145 IAEIAPAHIRGKLVSFNQFAIIFGQLVVYFVNYFIARsgdaswlntdgWRYMFASEAIPALLFLMLLYFVPETPRYLMSR 224
                        170       180
                 ....*....|....*....|....*.
gi 148223267 281 GKPEvacKALKKVAQINGKKEAGEKL 306
Cdd:PRK10077 225 GKQE---QAEGILRKIMGNTLATQAL 247
 
Name Accession Description Interval E-value
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
139-508 8.82e-29

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 116.26  E-value: 8.82e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 139 AQSIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPT 218
Cdd:cd06174   39 IVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLLLAFASSLWLLLVGRFLLGLGGGALYPAAAALIAEWFPP 118
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 219 GNRAFTSTATGYCYTMGQLVLVGLAFIIRD---WQWLQLAASIPFFFYFLYSWWIPesgrwlvlsgkpevackalkkvaq 295
Cdd:cd06174  119 KERGRALGLFSAGFGLGALLGPLLGGLLAEslgWRWLFLILAILGLLLALLLLFLL------------------------ 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 296 ingkkeagekltveilkssmqreinashnstysaldlvrtpvvrRISFCISCTWFSTSFAYYGLALDLQSFGVS------ 369
Cdd:cd06174  175 --------------------------------------------RLLLLLALAFFLLSFGYYGLLTYLPLYLQEvlglsa 210
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 370 --IYIIQIIFGTVDIPAKFISYFITTYVGRRVS-QAITLILAGIAILVNISVPQDFQTVrtAMAVFGKGCLAASFNCLYL 446
Cdd:cd06174  211 aeAGLLLSLFGLGGILGALLGGLLSDRLGRRRLlLLIGLLLAALGLLLLALAPSLALLL--VALLLLGFGLGFAFPALLT 288
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148223267 447 YTGELYPTVIRQTGMGLGAMMARLGGIIAPL--AQMTGDIYHSLPLIIFGCLPILSGIAGCFLP 508
Cdd:cd06174  289 LASELAPPEARGTASGLFNTFGSLGGALGPLlaGLLLDTGGYGGVFLILAALALLAALLLLLLP 352
2_A_01_02 TIGR00880
Multidrug resistance protein;
141-222 7.96e-05

Multidrug resistance protein;


Pssm-ID: 273318  Cd Length: 141  Bit Score: 41.48  E-value: 7.96e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  141 SIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPTGN 220
Cdd:TIGR00880   5 AGYALGQLIYSPLSGLLTDRFGRKPVLLVGLFIFVLSTAMFALSSNITVLIIARFLQGFGAAFALVAGAALIADIYPPEE 84

                  ..
gi 148223267  221 RA 222
Cdd:TIGR00880  85 RG 86
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
341-508 6.99e-04

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 40.76  E-value: 6.99e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 341 ISFCISCTWFSTSFAYYGLALDLQSFGVSIYIIQIIFGTVDIPAKFISYFITTYVGRRVSQAITLILAGIAILVnISVPQ 420
Cdd:cd06174    7 GFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLL-LAFAS 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 421 DFQTVRTAMAVFGKGClAASFNCLYLYTGELYPTVIRQTGMGLGAMMARLGGIIAPLAQMTGDIYHS--LPLIIFGCLPI 498
Cdd:cd06174   86 SLWLLLVGRFLLGLGG-GALYPAAAALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLGwrWLFLILAILGL 164
                        170
                 ....*....|
gi 148223267 499 LSGIAGCFLP 508
Cdd:cd06174  165 LLALLLLFLL 174
2A0119 TIGR00898
cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]
11-518 0e+00

cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273328 [Multi-domain]  Cd Length: 505  Bit Score: 544.23  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267   11 GGMGRYQVIHVVLLSLPVFMLASHNLMQNFTAATPSHHCRINGTyeeTNFTGPW-LRALLPMTPTGEFSKCLRYTTPQYE 89
Cdd:TIGR00898   1 GEFGPFQRRTFLLLALPIALLAFHFVLIVFLGATPEHHCRLPDA---ANLSSRCeLNLTLPRLPDGRPESCLRFMVDQWA 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267   90 L-----LENNLTQSYDDLETEPCLDGWVYDHSEFASTIITQWDLVCNHRRMRQVAQSIYMAGVLVGSILFGGLSDKFGRR 164
Cdd:TIGR00898  78 NpsllgCEPLKLSDLGLAATEPCLDGWEYSYDTFSSTIVTEWDLVCEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRK 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  165 PLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPTGNRAFTSTATGYCYTMGQLVLVGLAF 244
Cdd:TIGR00898 158 KVLLLSTLVTAVSGVLTAFSPNYTVFLVFRLLVGMGIGGIWVQAVVLNTEFLPKKQRAIVGTLIQVFFSLGLVLLPLVAY 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  245 IIRDWQWLQLAASIPFFFYFLYSWWIPESGRWLVLSGKPEVACKALKKVAQINGKkeageKLTVEILKSSMQREINASHN 324
Cdd:TIGR00898 238 FIPDWRWLQLAVSLPTFLFFLLSWFVPESPRWLISQGRIEEALKILQRIAKINGK-----KLPAEVLSLSLEKDLSSSKK 312
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  325 StYSALDLVRTPVVRRISFCISCTWFSTSFAYYGLALDLQSFGVSIYIIQIIFGTVDIPAKFISYFITTYVGRRVSQAIT 404
Cdd:TIGR00898 313 Q-YSFLDLFRTPNLRKTTLCLMMLWFTTAFSYYGLVLDLGNLGGNIYLDLFISGLVELPAKLITLLLIDRLGRRYTMAAS 391
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  405 LILAGIAILVNISVPQDFQTVRTAMAVFGKGCLAASFNCLYLYTGELYPTVIRQTGMGLGAMMARLGGIIAPLAQMTGDI 484
Cdd:TIGR00898 392 LLLAGVALLLLLFVPVDLYFLRTALAVLGKFGITSAFQMVYLYTAELYPTVVRNLGVGVCSTMARVGSIISPFLVYLGEK 471
                         490       500       510
                  ....*....|....*....|....*....|....
gi 148223267  485 YHSLPLIIFGCLPILSGIAGCFLPETLGVPLPET 518
Cdd:TIGR00898 472 WLFLPLVLFGGLALLAGILTLFLPETKGVPLPET 505
Sugar_tr pfam00083
Sugar (and other) transporter;
141-517 3.09e-30

Sugar (and other) transporter;


Pssm-ID: 249572 [Multi-domain]  Cd Length: 449  Bit Score: 121.64  E-value: 3.09e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  141 SIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWY--CIFRFLTGVAFSGIVLNSYSLTVEWIPT 218
Cdd:pfam00083  52 SIFSVGCLIGSLFAGKLGDRFGRKPSLLIANVLFVIGALLQGFAPGKSFYmlIVGRVIVGLGVGGISVLVPMYISEIAPK 131
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  219 GNRAFTSTATGYCYTMGQLV--LVGLAFII--RDWQWLQLAAS--IPFFFYFLYSWWIPESGRWLVLSGKPEVACKALKK 292
Cdd:pfam00083 132 KLRGALGSLYQLGITFGILVaaIIGLGLNKysNSDGWRIPLGLqfVPALLLLIGLLFLPESPRWLVLKGKLEEARAVLAK 211
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  293 vaqinGKKEAGEKLTVEILKSSMQREINASHNstySALDLVRTPVVRRISFCISCTWFST------SFAYYGLALdLQSF 366
Cdd:pfam00083 212 -----LRGVSDVDQEIQEIKDSLERSVSEEKA---SWLELFRGKTVRQRLLMGVMLQIFQqltginAIFYYSPTI-FETL 282
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  367 GV--SIYIIQIIFGTVDIPAKFISYFITTYVGRR--------VSQAITLILAGIAILVNISVPQDFqtVRTAMAVFGKGC 436
Cdd:pfam00083 283 GLsdSVLLVTIIVGVVNFVFTFIAIFLVDRFGRRpllllgaaGMAICMLVLGVALLGVNSSKAAGI--VAIVFILLFIAF 360
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  437 LAASFN-CLYLYTGELYPTVIRQTGMGLGAMMARLGGIIAPLA--QMTGDIYHSLPLIIFGCLPILSGIAGCFLPETLGV 513
Cdd:pfam00083 361 FALGWGpVPWVIVSELFPLGVRPKAMAIATAANWLANFLIGFLfpIITGAIGGYVFLVFAGLLVLFILFVFFFVPETKGR 440

                  ....
gi 148223267  514 PLPE 517
Cdd:pfam00083 441 TLEE 444
2A0115 TIGR00895
benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and ...
141-477 4.39e-25

benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273327 [Multi-domain]  Cd Length: 398  Bit Score: 106.29  E-value: 4.39e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  141 SIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPTGN 220
Cdd:TIGR00895  59 SAGLIGMAFGALFFGPLADRIGRRRVLLWSILLFSVFTLLCALATNVTQLLILRFLAGLGLGGLMPNLNALVSEYAPKRF 138
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  221 RAFTSTATGYCYTMGQLV---LVGLAFIIRDWQWL-QLAASIPFFFYFLYSWWIPESGRWLVLSGKPevacKALKKVAQI 296
Cdd:TIGR00895 139 RGTAVGLMFCGYPIGAAVggfLAGWLIPVFGWRSLfYVGGIAPLLLLLLLMRFLPESIDFLVSKRPE----TVRRIVNAI 214
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  297 NGKKEAGEKLTVEILKSSMQREinashnstYSALDLVRTPVVRRISFCISCTWFSTSFAYYGLA-------------LDL 363
Cdd:TIGR00895 215 APQMQAEAQSALPEQKSTQGTK--------RSVFKALFQGKTARITVLLWLLYFMLLVGVYFLTnwlpklmvelgfsLSL 286
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  364 QSFGVSIYIIQIIFGTVdipakFISYFITTYvGRRVSQAITLILAGIAILVNISVPQDfqTVRTAMAVFGKGCLAASFNC 443
Cdd:TIGR00895 287 AATGGALFNFGGVIGSI-----IFGWLADRL-GPRVTALLLLLGAVFAVLVGSTLFSP--TLLLLLGAIAGFFVNGGQSG 358
                         330       340       350
                  ....*....|....*....|....*....|....
gi 148223267  444 LYLYTGELYPTVIRQTGMGLGAMMARLGGIIAPL 477
Cdd:TIGR00895 359 LYALMALFYPTAIRATGVGWAIGIGRLGAIIGPI 392
SP TIGR00879
MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of ...
141-518 1.14e-24

MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273317 [Multi-domain]  Cd Length: 481  Bit Score: 105.88  E-value: 1.14e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  141 SIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLqMFVTG----ICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWI 216
Cdd:TIGR00879  78 SIFLVGGFIGALFAGWLSDRFGRKKSLLIIAL-LFVIGailmGLAAFALSVEMLIVGRVLLGIGVGIASALVPMYLSEIA 156
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  217 PTGNRAFTSTATGYCYTMGQLV--LVGLAFIIRD----WQWLQLAASIPFFFYFLYSWWIPESGRWLVLSGKPEVACKAL 290
Cdd:TIGR00879 157 PKALRGALTSLYQLAITFGILVayGFGSGKVSLNntlgWRIPLGLQLIPAGLLFLGLFFLPESPRWLVGKGRVEEARKSL 236
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  291 KKVAQINGkKEAGEKLTVEILKSSMQREINASHNSTYSALDLVRTPVVRR-ISFCISCT-WFS--TSFAYYGLALdLQSF 366
Cdd:TIGR00879 237 ARLRGTSG-EDKELLDELELIDIKRSIEKRSVQPSWGSLFSSTRRIRRRLfLGVVLQWFqQFTgiNAIMYYSPTI-FENA 314
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  367 GVS---IYIIQIIFGTVDIPAKFISYFITTYVGRR-------VSQAITLILagIAILVNISVPQDFQTVRTAMAVFGKGC 436
Cdd:TIGR00879 315 GVStdhAFLVSIIVGAVNFAFTFVAIFLVDRFGRRpllligaAGMAICLFV--LGILGASFVTGSSKSSGNVAIVFILLF 392
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  437 LAAsFN-----CLYLYTGELYPTVIRQTGMGLGAMMARLGGIIAPLA--QMTGDIYHSLPLIIFGCLPILSGI-AGCFLP 508
Cdd:TIGR00879 393 IAF-FAmgwgpVPWVIVSEIFPLSLRPKGISIAVAANWLANFIVGFLfpTMLESIGVGGVFIFFGGLNVLGLIfVYFFLP 471
                         410
                  ....*....|
gi 148223267  509 ETLGVPLPET 518
Cdd:TIGR00879 472 ETKGRTLEEI 481
MFS_1 pfam07690
Major Facilitator Superfamily;
141-476 2.84e-19

Major Facilitator Superfamily;


Pssm-ID: 254360 [Multi-domain]  Cd Length: 346  Bit Score: 87.86  E-value: 2.84e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  141 SIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPTGN 220
Cdd:pfam07690  39 TAFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLLFASSLWLLLVLRVLQGLGGGALFPAAAALIADWFPPEE 118
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  221 RAFTSTATGYCYTMGQLV---LVGLAFIIRDWQWLQLAASIPFFFYFLYSWWIpesgrwlvlsgkpevackalkkvaqin 297
Cdd:pfam07690 119 RGRALGLLSAGFGLGAALgplLGGLLASLFGWRAAFLILAILALLAAVLAALL--------------------------- 171
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  298 gkkeagekLTVEILKSSMQREINASHNSTYSALDLVRTPVVRRISFCISCTWFSTSFAYYGLALDLQSFGVS---IYIIQ 374
Cdd:pfam07690 172 --------LPRPPPESKRPKPAEEAPAPLLPAWKLLLRDPVLWLLLALLLFGFAFFALLTYLPLYQEVLGLSallAGLLL 243
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  375 IIFGTVDIPAKFISYFITTYVGRRVSQAITLILAGIA--ILVNISVPQDFQTVRTAMAVFGKGcLAASFNCLYLYTGELY 452
Cdd:pfam07690 244 GLAGLLGAIGRLLLGRLSDRLGRRRRLLLALLLLILAalGLALLSLTESSLWLLLALLLLGFG-FGLVFPALNALVSDLA 322
                         330       340
                  ....*....|....*....|....
gi 148223267  453 PTVIRQTGMGLGAMMARLGGIIAP 476
Cdd:pfam07690 323 PKEERGTASGLYNTAGSLGGALGP 346
synapt_SV2 TIGR01299
synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger ...
141-361 3.87e-12

synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.


Pssm-ID: 130366 [Multi-domain]  Cd Length: 742  Bit Score: 67.69  E-value: 3.87e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  141 SIYMAGVLVGSILFGGLSDKFGRRPLNIWSnlqMFVTGICAAFSP---NYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIP 217
Cdd:TIGR01299 209 LIVYLGMMVGAFFWGGLADKLGRKQCLLIC---LSVNGFFAFFSSfvqGYGFFLFCRLLSGFGIGGAIPIVFSYFAEFLA 285
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  218 TGNRA--------FTSTATGYCYTMGQLVL--------VGLAFIIRDWQWLQLAASIPFFFYFLYSWWIPESGRWLVLSG 281
Cdd:TIGR01299 286 QEKRGehlswlcmFWMIGGIYAAAMAWAIIphygwsfqMGSAYQFHSWRVFVIVCAFPCVFAIGALTFMPESPRFFLENG 365
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  282 KPEVACKALKKVAQIN--GKKEAGEKLTVEILKSSMQR----EINASHNSTYSA-------------LDLVR--TPVVRR 340
Cdd:TIGR01299 366 KHDEAWMILKLIHDTNmrAKGHPEKVFSVNHIKTIHQEdeliEIESDTGTWYQRcfvralsegggiwGNFLRcfNPEVRE 445
                         250       260
                  ....*....|....*....|.
gi 148223267  341 ISFCISCTWFSTSFAYYGLAL 361
Cdd:TIGR01299 446 ITIKLMGVWFTLSFGYYGLSV 466
2A0112 TIGR00891
putative sialic acid transporter; [Transport and binding proteins, Carbohydrates, organic ...
149-479 1.53e-10

putative sialic acid transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273324 [Multi-domain]  Cd Length: 405  Bit Score: 61.82  E-value: 1.53e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  149 VGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPTGNRAFTSTAT 228
Cdd:TIGR00891  62 FGALMFGLWGDRYGRRLPMVTSIVLFSAGTLACGFAPGYITMFIARLVIGIGMGGEYGSSAAYVIESWPKHLRNKASGLL 141
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  229 GYCYTMGQLV-----LVGLAFIIRDWQWLQLAASIPFFFYFLYSWWIPESGRWlvlsgkpEVACKALKKVAQINGKKEAG 303
Cdd:TIGR00891 142 ISGYAVGAVVaaqvySLVVPVWGDGWRALFFISILPIIFALWLRKNIPEAEDW-------KEKHAGKALVRTMVDILYGG 214
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  304 EKLTVEILKSSMqreinASHNSTYSALDLVRTPVVRRISFCISCTWFSTSFAYYGLALDLQSFGVSIYIIQIIFGTVDIP 383
Cdd:TIGR00891 215 EHRIANIVMTLA-----AAMVQSAGKRWPTFVYLVVLVLFANLYSHPIQDLLPTYLKADLGLSPHTVANIVVFSNIGAIV 289
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  384 AKFISYFITTYVGRRVSQAITLILAGIAIlvnisVPQdFQTVRTAmAVFGKG------CLAASFNCLYLYTGELYPTVIR 457
Cdd:TIGR00891 290 GGCVFGFLGDWLGRRKAYVCSLLAGQLLI-----IPV-FAIGANV-AVLGLGlffqqmLVQGIWGILPKHLGEYFPTDQR 362
                         330       340
                  ....*....|....*....|..
gi 148223267  458 QTGMGLGAMMARLGGIIAPLAQ 479
Cdd:TIGR00891 363 AAGLGFTYQLGNLGGALAPIIG 384
AraJ COG2814
Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];
141-222 1.33e-07

Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];


Pssm-ID: 225371 [Multi-domain]  Cd Length: 394  Bit Score: 52.62  E-value: 1.33e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 141 SIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPTGN 220
Cdd:COG2814   55 TAYALGVALGAPLLALLTGRLERRRLLLGLLALFIVSNLLSALAPSFAVLLLARALAGLAHGVFWSIAAALAARLVPPGK 134

                 ..
gi 148223267 221 RA 222
Cdd:COG2814  135 RG 136
2A0109 TIGR00887
phosphate:H+ symporter; This model represents the phosphate uptake symporter subfamily of the ...
145-517 5.15e-07

phosphate:H+ symporter; This model represents the phosphate uptake symporter subfamily of the major facilitator superfamily (pfam00083). [Transport and binding proteins, Anions]


Pssm-ID: 129965 [Multi-domain]  Cd Length: 502  Bit Score: 50.88  E-value: 5.15e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  145 AGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNY------IWYCIFRFLTGVAFSGIVLNSYSLTVEWIPT 218
Cdd:TIGR00887  67 IGTLAGQLFFGWLADKLGRKRVYGMELIIMIIATVASGLSPGSspksvmATLCFWRFWLGVGIGGDYPLSAIITSEFATK 146
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  219 GNRAFTSTATGYCYTMGQLV------LVGLAF--------------------IIRDWQWLQLAASIPFFFYFLYSWWIPE 272
Cdd:TIGR00887 147 KWRGAMMAAVFAMQGFGILAgaivalIVLAGFkhsleaaadeasctgscvpaVDYMWRILIGFGAVPALLALYFRLTIPE 226
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  273 SGRWLVLSGKP-EVACKALKKVAQINGKKEAGEKltveilkssmQREINASHNSTYSALDLVRTPVVRR---ISFCISCT 348
Cdd:TIGR00887 227 TPRYTADVAKDvEQAASDMSAVLQVKIEAEPDEV----------EKASTAVEVPKASWSDFFTHFFKWRhgkHLLGTAGS 296
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  349 WFSTSFAYYGLALD----LQSFGVS-----------IY------IIQIIFGTVdiPAKFISYFITTYVGRRVSQAITLIL 407
Cdd:TIGR00887 297 WFLLDIAFYGVNLNqkviLSAIGYSppaatnnayeeLYktavgnLIIALAGTV--PGYWVTVFLVDIIGRKPIQLMGFFI 374
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  408 AGIAILVnISVPQDFQTVRTAMAVFGKGCLAASFN---CLYLYTGELYPTVIRQTGMGLGAMMARLGGIIA-----PLAQ 479
Cdd:TIGR00887 375 LTVLFFV-LGFAYNHLSTHGFLAIYVLAQFFANFGpnaTTFIVPGEVFPTRYRSTAHGISAASGKAGAIIGqfgflYLAQ 453
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|....*
gi 148223267  480 MTG--DIYHSLP-----LIIFGCLPILSGIAGCFLPETLGVPLPE 517
Cdd:TIGR00887 454 HGDptKGYPTGIwmghvLEIFALFMFLGILFTLLIPETKGKSLEE 498
2A0106 TIGR00883
metabolite-proton symporter; This model represents the metabolite:H+ symport subfamily of the ...
149-485 2.96e-06

metabolite-proton symporter; This model represents the metabolite:H+ symport subfamily of the major facilitator superfamily (pfam00083), including citrate-H+ symporters, dicarboxylate:H+ symporters, the proline/glycine-betaine transporter ProP, etc. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273320 [Multi-domain]  Cd Length: 394  Bit Score: 48.04  E-value: 2.96e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  149 VGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNY----IW----YCIFRFLTGVAFSGIVLNSYSLTVEWIPTGN 220
Cdd:TIGR00883  50 LGAIVFGHFGDRIGRKKTLVITLLMMGIGTLLIGLLPSYatigIWapilLLLARLIQGFSLGGEWGGAALYLAEYAPPGK 129
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  221 RAFTSTATGYCYTMGQLVLVGLAFII---------RDWQWlqlaaSIPFFFyflySWWIPESGRWLVLSgkpevackaLK 291
Cdd:TIGR00883 130 RGFYGSFQQVGAPVGLLLAALTVLLLsyllgddalLEWGW-----RIPFLV----SAVLVLIGLYLRRN---------LE 191
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  292 KVAQINGKKEAGEKLTVEIlkssmqREINASHnstysaldlvRTPVVRRISFCISC-------TWFSTSFAYYGLALDLQ 364
Cdd:TIGR00883 192 ETPVFEKAQEKHKKKRGPI------AETLTKH----------RKPFLLGLGLVIATtttfyliTTYLPTYLTQTLGLSAN 255
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  365 SFGVSIYIIQIIFGTVdIPakfISYFITTYVGRRVSQAITLILAGI------AILVNISVPQDFQTVRTAMAVFGKG--C 436
Cdd:TIGR00883 256 SALLVLMLSLILFFIT-IP---LSGALSDRIGRRPVLIIFTVLAALlavpllMALLDSGSFTLFFFLVLGMALIGGMytG 331
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 148223267  437 LAASFNclylytGELYPTVIRQTGMGLGAMMAR-LGGIIAP-----LAQMTGDIY 485
Cdd:TIGR00883 332 PMGSFL------PELFPTEVRYTGASLAYNLAGaIFGGFAPyiaaaLVAMTGDWY 380
ProP COG0477
MFS family permease [Carbohydrate transport and metabolism, Amino acid transport and ...
118-414 4.43e-06

MFS family permease [Carbohydrate transport and metabolism, Amino acid transport and metabolism, Inorganic ion transport and metabolism, General function prediction only];


Pssm-ID: 223553 [Multi-domain]  Cd Length: 338  Bit Score: 47.38  E-value: 4.43e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 118 FASTIITQWDLVCNHRRMRQVAQSIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPN--YIWYCIFRF 195
Cdd:COG0477   23 PALPLLLSTLSLSSGRLLYGLLLSAFFLGYAIGSLLAGPLGDRYGRRKVLIIGLLLFLLGTLLLALAPNvgLALLLILRL 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 196 LTGVAFSGIVLNSYSLTVEWIPTGNRA--FTSTATGYCYTMGQLVLVGLAFIIRDWQWLQLAASIPFFFYFLYSWWIPES 273
Cdd:COG0477  103 LQGLGGGGLLPVASALLSEWFPEATERglAVGLVTLGAGALGLALGPLLAGLLLGALLWGWRAAFLLAALLGLLLLILVL 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 274 GRWLVLSGKPEVACKALKKVAQINGKKEAGEKLTVEILKSSMQREINASHNSTYSALDLVRTPVVRRISFCISCTWFSTS 353
Cdd:COG0477  183 LLDLLLAAPRLPLAVGLALIELGKLLLLLLILLLGGLVLLLLGLYLSAAGFGLRALLLGLGLALLALFVGALILLVLLPI 262
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 148223267 354 FAYYGLALDLQSFGVSIYIIQIIFGTVDIPAKFISYFITTYVGRRVSQAITLILAGIAILV 414
Cdd:COG0477  263 LLGAAGGLSALVGAAGGLLALILLGLAGLLGTLVGGSLLVDRLGRSLGLRAILLAGALLLA 323
xylE PRK10077
D-xylose transporter XylE; Provisional
146-306 4.91e-06

D-xylose transporter XylE; Provisional


Pssm-ID: 182225 [Multi-domain]  Cd Length: 479  Bit Score: 47.77  E-value: 4.91e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 146 GVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAF-----------SPNYIW-YCIFRFL--TGVAFSGIVLNSYsl 211
Cdd:PRK10077  67 GCIIGGALGGYCSNRFGRRDSLKIAAVLFFISALGSAWpefgftsigpdNTGYVPeFVIYRIIggIGVGLASMLSPMY-- 144
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 212 TVEWIPTGNRAFTSTATGYCYTMGQLVLVGLAFIIRD-----------WQWLQLAASIPFFFYFLYSWWIPESGRWLVLS 280
Cdd:PRK10077 145 IAEIAPAHIRGKLVSFNQFAIIFGQLVVYFVNYFIARsgdaswlntdgWRYMFASEAIPALLFLMLLYFVPETPRYLMSR 224
                        170       180
                 ....*....|....*....|....*.
gi 148223267 281 GKPEvacKALKKVAQINGKKEAGEKL 306
Cdd:PRK10077 225 GKQE---QAEGILRKIMGNTLATQAL 247
PRK03893 PRK03893
putative sialic acid transporter; Provisional
150-276 9.27e-05

putative sialic acid transporter; Provisional


Pssm-ID: 179668 [Multi-domain]  Cd Length: 496  Bit Score: 43.53  E-value: 9.27e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 150 GSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPtgnRAFTSTATG 229
Cdd:PRK03893  71 GGLLLGAMGDRYGRRLAMVISIVLFSVGTLACGFAPGYWTLFIARLVIGMGMAGEYGSSATYVIESWP---KHLRNKASG 147
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 148223267 230 YC---YTMGQLVLVGLAFIIRD---WQWLQLAASIPFFFyflySWW----IPESGRW 276
Cdd:PRK03893 148 FLisgFSIGAVVAAQVYSLVVPvwgWRALFFIGILPIIF----ALWlrknLPEAEDW 200
Sugar_tr pfam00083
Sugar (and other) transporter;
341-510 3.00e-04

Sugar (and other) transporter;


Pssm-ID: 249572 [Multi-domain]  Cd Length: 449  Bit Score: 41.90  E-value: 3.00e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  341 ISFCISCTWFSTSFAYYGLALdLQSFGVSIYIIQIIFGTvdipakFISYFITTYVGRRVSQAITLILAGIAILVNISVPQ 420
Cdd:pfam00083  25 IKFFKRFGALTSIGADYLSTS-LSGLIVSIFSVGCLIGS------LFAGKLGDRFGRKPSLLIANVLFVIGALLQGFAPG 97
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  421 D-FQTVRTAMAVFGKGCLAASfNCLYLYTGELYPTVIR-------QTGMGLGAMMArlGGIIAPLAQMTGDIYHSLPLII 492
Cdd:pfam00083  98 KsFYMLIVGRVIVGLGVGGIS-VLVPMYISEIAPKKLRgalgslyQLGITFGILVA--AIIGLGLNKYSNSDGWRIPLGL 174
                         170
                  ....*....|....*...
gi 148223267  493 FGCLPILSGIAGCFLPET 510
Cdd:pfam00083 175 QFVPALLLLIGLLFLPES 192
MFS_1 pfam07690
Major Facilitator Superfamily;
341-507 4.80e-04

Major Facilitator Superfamily;


Pssm-ID: 254360 [Multi-domain]  Cd Length: 346  Bit Score: 41.25  E-value: 4.80e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  341 ISFCISCTWFSTSFAYYGLALDL-QSFGVSIYIIQII---FGTVDIPAKFISYFITTYVGRRVSQAITLILAGIAILVNI 416
Cdd:pfam07690   1 LFLAAFLAGLGRSLLGPALPLYLaEDLGISPTEIGLLltaFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  417 SVPQDFQTVrtAMAVFGKGCLAASFNCLYLYTGELYPTVIRQTGMGLGAMMARLGGIIAP-LAQMTGDIYH-SLPLIIFG 494
Cdd:pfam07690  81 FASSLWLLL--VLRVLQGLGGGALFPAAAALIADWFPPEERGRALGLLSAGFGLGAALGPlLGGLLASLFGwRAAFLILA 158
                         170
                  ....*....|...
gi 148223267  495 CLPILSGIAGCFL 507
Cdd:pfam07690 159 ILALLAAVLAALL 171
PRK12307 PRK12307
putative sialic acid transporter; Provisional
149-217 1.20e-03

putative sialic acid transporter; Provisional


Pssm-ID: 237051 [Multi-domain]  Cd Length: 426  Bit Score: 39.91  E-value: 1.20e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 148223267 149 VGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIP 217
Cdd:PRK12307  68 FGGALFGLLADKFGRKPLMMWSIVAYSVGTGLSGLASGVIMLTLSRFIVGMGMAGEYACASTYAVESWP 136
2A0114 TIGR00893
D-galactonate transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, ...
141-252 1.78e-03

D-galactonate transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273326 [Multi-domain]  Cd Length: 399  Bit Score: 39.24  E-value: 1.78e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267  141 SIYMAGVLVGSILFGGLSDKFGRRplnIWSNLQMFVTGICA---AFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIP 217
Cdd:TIGR00893  36 SAFSWGYVVGQFPGGWLLDRFGAR---KTLAVFIVIWGVFTglqAFAGAYVSLYILRVLLGAAEAPFFPGIILIVASWFP 112
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 148223267  218 TGNRAftsTATGYcYTMGQLV-------LVGLAFIIRDWQWL 252
Cdd:TIGR00893 113 ASERA---TAVSI-FNSAQGLggiiggpLVGWILIHFSWQWA 150
efflux_Bcr_CflA TIGR00710
drug resistance transporter, Bcr/CflA subfamily; This subfamily of drug efflux proteins, a ...
137-211 2.14e-03

drug resistance transporter, Bcr/CflA subfamily; This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 12 membrane-spanning regions. Members with known activity include Bcr (bicyclomycin resistance protein) in E. coli, Flor (chloramphenicol and florfenicol resistance) in Salmonella typhimurium DT104, and CmlA (chloramphenicol resistance) in Pseudomonas sp. plasmid R1033.


Pssm-ID: 273229 [Multi-domain]  Cd Length: 385  Bit Score: 39.29  E-value: 2.14e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 148223267  137 QVAQSIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSL 211
Cdd:TIGR00710  43 QMTLTLYLLGFAAGQLLWGPLSDRYGRRPVLLLGLFIFALSSLGLALSNNIETLLVLRFVQAFGASAGSVISQAL 117
PRK11551 PRK11551
putative 3-hydroxyphenylpropionic transporter MhpT; Provisional
134-231 3.81e-03

putative 3-hydroxyphenylpropionic transporter MhpT; Provisional


Pssm-ID: 236927 [Multi-domain]  Cd Length: 406  Bit Score: 38.40  E-value: 3.81e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 134 RMRQ-----VAQ-----SIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSG 203
Cdd:PRK11551  40 RMAQefgldVAQmgwafSAGILGLLPGALLGGRLADRIGRKRILIVSVALFGLFSLATAQAWDFPSLLVARLLTGVGLGG 119
                         90       100       110
                 ....*....|....*....|....*....|
gi 148223267 204 IVLNSYSLTVEWIPTGNRaftSTATG--YC 231
Cdd:PRK11551 120 ALPNLIALTSEAVGPRLR---GTAVSlmYC 146
PRK09952 PRK09952
shikimate transporter; Provisional
149-270 5.06e-03

shikimate transporter; Provisional


Pssm-ID: 182163 [Multi-domain]  Cd Length: 438  Bit Score: 38.17  E-value: 5.06e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148223267 149 VGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYI---WYC-----IFRFLTGVAFSGIVLNSYSLTVEWIPTGN 220
Cdd:PRK09952  79 LGGVVFGHFGDRLGRKRMLMLTVWMMGIATALIGLLPSFStigWWApvllvTLRAIQGFAVGGEWGGAALLAVESAPKNK 158
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 148223267 221 RAFTSTATGYCYTMGQLVLVGLAFIIR----DWQWLQLAASIPFFF---YFLYSWWI 270
Cdd:PRK09952 159 KAFYSSGVQVGYGVGLLLSTGLVSLISmmttDEQFLSWGWRIPFLFsivLVLIALWV 215
PRK15402 PRK15402
multidrug efflux system translocase MdfA; Provisional
141-209 6.19e-03

multidrug efflux system translocase MdfA; Provisional


Pssm-ID: 185300 [Multi-domain]  Cd Length: 406  Bit Score: 37.61  E-value: 6.19e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 148223267 141 SIYMAGVLVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSY 209
Cdd:PRK15402  55 TAYLAGGMFLQWLLGPLSDRIGRRPVMLAGVAFFILTCLAILLAQSIEQFTLLRFLQGIGLCFIGAVGY 123
YejE COG4239
ABC-type microcin C transport system, permease component YejE [Secondary metabolites ...
146-209 7.50e-03

ABC-type microcin C transport system, permease component YejE [Secondary metabolites biosynthesis, transport and catabolism];


Pssm-ID: 226690 [Multi-domain]  Cd Length: 341  Bit Score: 37.36  E-value: 7.50e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 148223267 146 GVLVGSI--LFGGLSDKFGRRPLNIWSNLQMF--VTGICAAFSPNYIWYCIFRFLTG-VAFSGIVLNSY 209
Cdd:COG4239  158 GVLAGALqgYFGGWVDLLGQRFIEVWSGMPTLylLIILASIFQPNFWWLLGIMLLFGwMSLVGVVRAEF 226
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH