NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|147902262|ref|NP_001091564|]
View 

exostosin-1 [Bos taurus]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Glyco_transf_64 pfam09258
Glycosyl transferase family 64 domain; Members of this family catalyse the transfer reaction ...
480-729 3.56e-126

Glycosyl transferase family 64 domain; Members of this family catalyse the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analog of the natural common linker of various glycosylaminoglycans. They are also required for the biosynthesis of heparan-sulphate.


:

Pssm-ID: 255252  Cd Length: 244  Bit Score: 378.93  E-value: 3.56e-126
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  480 FTAVIHAVtplVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATSVPVIVIEGESKVMSSRFLPYDNIITD 559
Cdd:pfam09258   1 FTAVINTY---YSRIDLLRKLLNHYAGSPHLAKIVVLWNNPKPPPELSKWPSPAVPLTVIRTKRNSLNNRFLPYPEIETD 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  560 AVLSLDEDTVLSTTEVDFAFTVWQSFPERIVGYPARSHFWDNSKERWGYTSKWTNDYSMVLTGAAIYHKYYHYLYTHYLP 639
Cdd:pfam09258  78 AVLSLDDDILLSTDELDFAFSVWQSFPDRIVGFPPRSHFWDLSKGRWGYTSEWTNDYSMVLTGAAFYHRYYLYLYTHSLP 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  640 ASLKNMVDQLANCEDILMNFLVSAVTKLPPIKVTQKKQYKETMMGQTsraSRWADPDHFAQRQSCMNTFASWFGYMPLIH 719
Cdd:pfam09258 158 KSIRDLVDETRNCEDILMNFLVANVTGKPPIKVTSRKQYKEGRNGKV---GLSSDPGHFLQRSKCINKFSKIFGYMPLVY 234
                         250
                  ....*....|
gi 147902262  720 SQMRLDPVLF 729
Cdd:pfam09258 235 SYIRADPVLF 244
Exostosin pfam03016
Exostosin family; The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on ...
110-396 1.88e-73

Exostosin family; The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on 8q24.1, EXT2 on 11p11-13, and EXT3 on 19p have been associated with the autosomal dominant disorder known as hereditary multiple exostoses (HME). This is the most common known skeletal dysplasia. The chromosomal locations of other EXT genes suggest association with other forms of neoplasia. EXT1 and EXT2 have both been shown to encode a heparan sulphate polymerase with both D-glucuronyl (GlcA) and N-acetyl-D-glucosaminoglycan (GlcNAC) transferase activities. The nature of the defect in heparan sulphate biosynthesis in HME is unclear.


:

Pssm-ID: 251675  Cd Length: 292  Bit Score: 242.35  E-value: 1.88e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  110 KKNGFKVYVYPQQKGEKIAE---------------SYQNILAAIEGSRFYTSDPSQACLFVLSLDTLDRD----QLSPQY 170
Cdd:pfam03016   1 SCKGLKVYVYDLPRRFNLLEdvlpetswylthqyaAESILHKSILNSRCRTLDPDEADLFFVPFYTSLSVgtnaVERDLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  171 VHNLRSKVQSLHLWN--NGRNHLIFNLYS--GTWPDYTEDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSKDHPRTGG 246
Cdd:pfam03016  81 PSELVEWLESLPYWNrsGGRDHIIVNSHPfgGSAFDRLPALNNNTILAVLAGGGFSEDQFRPGFDVPLPAYFHPNSVDDL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  247 ERGFLKFNTipplRKYMLVFKGKRYLTGIGSDtrnalyhvHNGEDVVLLTTCKHGKDWQkhkdsrCDRDNTEYEKYDYRE 326
Cdd:pfam03016 161 ESDGMPPSK----RKTLLFFAGGPRPAGKGAL--------ANAIRDLLIEECKNSPDFQ------CEGNQSCGNPENYME 222
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  327 MLHNATFCLVPRGRRLGSFRFLEALQAACVPVMLSNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSI 396
Cdd:pfam03016 223 LLRSSRFCLVPPGDTPTSPRLFDALRAGCIPVIISDGWELPFEDVIDWSKFSVRVPENDIPSLPEILRAI 292
 
Name Accession Description Interval E-value
Glyco_transf_64 pfam09258
Glycosyl transferase family 64 domain; Members of this family catalyse the transfer reaction ...
480-729 3.56e-126

Glycosyl transferase family 64 domain; Members of this family catalyse the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analog of the natural common linker of various glycosylaminoglycans. They are also required for the biosynthesis of heparan-sulphate.


Pssm-ID: 255252  Cd Length: 244  Bit Score: 378.93  E-value: 3.56e-126
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  480 FTAVIHAVtplVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATSVPVIVIEGESKVMSSRFLPYDNIITD 559
Cdd:pfam09258   1 FTAVINTY---YSRIDLLRKLLNHYAGSPHLAKIVVLWNNPKPPPELSKWPSPAVPLTVIRTKRNSLNNRFLPYPEIETD 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  560 AVLSLDEDTVLSTTEVDFAFTVWQSFPERIVGYPARSHFWDNSKERWGYTSKWTNDYSMVLTGAAIYHKYYHYLYTHYLP 639
Cdd:pfam09258  78 AVLSLDDDILLSTDELDFAFSVWQSFPDRIVGFPPRSHFWDLSKGRWGYTSEWTNDYSMVLTGAAFYHRYYLYLYTHSLP 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  640 ASLKNMVDQLANCEDILMNFLVSAVTKLPPIKVTQKKQYKETMMGQTsraSRWADPDHFAQRQSCMNTFASWFGYMPLIH 719
Cdd:pfam09258 158 KSIRDLVDETRNCEDILMNFLVANVTGKPPIKVTSRKQYKEGRNGKV---GLSSDPGHFLQRSKCINKFSKIFGYMPLVY 234
                         250
                  ....*....|
gi 147902262  720 SQMRLDPVLF 729
Cdd:pfam09258 235 SYIRADPVLF 244
Exostosin pfam03016
Exostosin family; The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on ...
110-396 1.88e-73

Exostosin family; The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on 8q24.1, EXT2 on 11p11-13, and EXT3 on 19p have been associated with the autosomal dominant disorder known as hereditary multiple exostoses (HME). This is the most common known skeletal dysplasia. The chromosomal locations of other EXT genes suggest association with other forms of neoplasia. EXT1 and EXT2 have both been shown to encode a heparan sulphate polymerase with both D-glucuronyl (GlcA) and N-acetyl-D-glucosaminoglycan (GlcNAC) transferase activities. The nature of the defect in heparan sulphate biosynthesis in HME is unclear.


Pssm-ID: 251675  Cd Length: 292  Bit Score: 242.35  E-value: 1.88e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  110 KKNGFKVYVYPQQKGEKIAE---------------SYQNILAAIEGSRFYTSDPSQACLFVLSLDTLDRD----QLSPQY 170
Cdd:pfam03016   1 SCKGLKVYVYDLPRRFNLLEdvlpetswylthqyaAESILHKSILNSRCRTLDPDEADLFFVPFYTSLSVgtnaVERDLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  171 VHNLRSKVQSLHLWN--NGRNHLIFNLYS--GTWPDYTEDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSKDHPRTGG 246
Cdd:pfam03016  81 PSELVEWLESLPYWNrsGGRDHIIVNSHPfgGSAFDRLPALNNNTILAVLAGGGFSEDQFRPGFDVPLPAYFHPNSVDDL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  247 ERGFLKFNTipplRKYMLVFKGKRYLTGIGSDtrnalyhvHNGEDVVLLTTCKHGKDWQkhkdsrCDRDNTEYEKYDYRE 326
Cdd:pfam03016 161 ESDGMPPSK----RKTLLFFAGGPRPAGKGAL--------ANAIRDLLIEECKNSPDFQ------CEGNQSCGNPENYME 222
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  327 MLHNATFCLVPRGRRLGSFRFLEALQAACVPVMLSNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSI 396
Cdd:pfam03016 223 LLRSSRFCLVPPGDTPTSPRLFDALRAGCIPVIISDGWELPFEDVIDWSKFSVRVPENDIPSLPEILRAI 292
 
Name Accession Description Interval E-value
Glyco_transf_64 pfam09258
Glycosyl transferase family 64 domain; Members of this family catalyse the transfer reaction ...
480-729 3.56e-126

Glycosyl transferase family 64 domain; Members of this family catalyse the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analog of the natural common linker of various glycosylaminoglycans. They are also required for the biosynthesis of heparan-sulphate.


Pssm-ID: 255252  Cd Length: 244  Bit Score: 378.93  E-value: 3.56e-126
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  480 FTAVIHAVtplVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATSVPVIVIEGESKVMSSRFLPYDNIITD 559
Cdd:pfam09258   1 FTAVINTY---YSRIDLLRKLLNHYAGSPHLAKIVVLWNNPKPPPELSKWPSPAVPLTVIRTKRNSLNNRFLPYPEIETD 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  560 AVLSLDEDTVLSTTEVDFAFTVWQSFPERIVGYPARSHFWDNSKERWGYTSKWTNDYSMVLTGAAIYHKYYHYLYTHYLP 639
Cdd:pfam09258  78 AVLSLDDDILLSTDELDFAFSVWQSFPDRIVGFPPRSHFWDLSKGRWGYTSEWTNDYSMVLTGAAFYHRYYLYLYTHSLP 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  640 ASLKNMVDQLANCEDILMNFLVSAVTKLPPIKVTQKKQYKETMMGQTsraSRWADPDHFAQRQSCMNTFASWFGYMPLIH 719
Cdd:pfam09258 158 KSIRDLVDETRNCEDILMNFLVANVTGKPPIKVTSRKQYKEGRNGKV---GLSSDPGHFLQRSKCINKFSKIFGYMPLVY 234
                         250
                  ....*....|
gi 147902262  720 SQMRLDPVLF 729
Cdd:pfam09258 235 SYIRADPVLF 244
Exostosin pfam03016
Exostosin family; The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on ...
110-396 1.88e-73

Exostosin family; The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on 8q24.1, EXT2 on 11p11-13, and EXT3 on 19p have been associated with the autosomal dominant disorder known as hereditary multiple exostoses (HME). This is the most common known skeletal dysplasia. The chromosomal locations of other EXT genes suggest association with other forms of neoplasia. EXT1 and EXT2 have both been shown to encode a heparan sulphate polymerase with both D-glucuronyl (GlcA) and N-acetyl-D-glucosaminoglycan (GlcNAC) transferase activities. The nature of the defect in heparan sulphate biosynthesis in HME is unclear.


Pssm-ID: 251675  Cd Length: 292  Bit Score: 242.35  E-value: 1.88e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  110 KKNGFKVYVYPQQKGEKIAE---------------SYQNILAAIEGSRFYTSDPSQACLFVLSLDTLDRD----QLSPQY 170
Cdd:pfam03016   1 SCKGLKVYVYDLPRRFNLLEdvlpetswylthqyaAESILHKSILNSRCRTLDPDEADLFFVPFYTSLSVgtnaVERDLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  171 VHNLRSKVQSLHLWN--NGRNHLIFNLYS--GTWPDYTEDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSKDHPRTGG 246
Cdd:pfam03016  81 PSELVEWLESLPYWNrsGGRDHIIVNSHPfgGSAFDRLPALNNNTILAVLAGGGFSEDQFRPGFDVPLPAYFHPNSVDDL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  247 ERGFLKFNTipplRKYMLVFKGKRYLTGIGSDtrnalyhvHNGEDVVLLTTCKHGKDWQkhkdsrCDRDNTEYEKYDYRE 326
Cdd:pfam03016 161 ESDGMPPSK----RKTLLFFAGGPRPAGKGAL--------ANAIRDLLIEECKNSPDFQ------CEGNQSCGNPENYME 222
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147902262  327 MLHNATFCLVPRGRRLGSFRFLEALQAACVPVMLSNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSI 396
Cdd:pfam03016 223 LLRSSRFCLVPPGDTPTSPRLFDALRAGCIPVIISDGWELPFEDVIDWSKFSVRVPENDIPSLPEILRAI 292
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH