NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|147899025|ref|NP_001089438|]
View 

adiponectin receptor 1 [Xenopus laevis]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HlyIII pfam03006
Haemolysin-III related; Members of this family are integral membrane proteins. This family ...
138-361 3.37e-54

Haemolysin-III related; Members of this family are integral membrane proteins. This family includes a protein with hemolytic activity from Bacillus cereus. It has been proposed that YOL002c encodes a Saccharomyces cerevisiae protein that plays a key role in metabolic pathways that regulate lipid and phosphate metabolizm. In eukaryotes, members are seven-transmembrane pass molecules found to encode functional receptors with a broad range of apparent ligand specificities, including progestin and adipoQ receptors, and hence have been named PAQR proteins. The mammalian members include progesterone binding proteins. Unlike the case with GPCR receptor proteins, the evolutionary ancestry of the members of this family can be traced back to the Archaea.


:

Pssm-ID: 251670  Cd Length: 207  Bit Score: 179.76  E-value: 3.37e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025  138 FRIHTETGNIWTHLLGFVLFLFLGVLTMLRPNMYFmaPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSE-KVSRTFSKL 216
Cdd:pfam03006   1 FSLHNETANIWTHLLGAILFIVLLIFLLVLASLGG--SPWAVVPFSIYGLSLFLLLLVSTLYHLFSCHSEgRVKYILRKL 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025  217 DYSGIALLIMGSFVPWLYYSFycSPQPRLIYLSIVCVLGISAIIVAQWDRfstPKHRPTRAGVFLGLGLSGIVPTLHFti 296
Cdd:pfam03006  79 DHSGIYLLIAGSYTPFLLYAL--CGPLGWILLIFIWGLALLGILLKLFPL---KRFRWLRTVLYLLMGWLGIIPIKHL-- 151
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 147899025  297 aegfVKATTVGQMGWFFLMAVMYITGAGLYAARiperfFPGKFDIWFQSHQIFHVLVVAAAFIHL 361
Cdd:pfam03006 152 ----ILALGGGGLVLLVLGGVLYTLGAIFYALR-----FPGPFDIWGHSHQIFHLFVVLGALCHY 207
 
Name Accession Description Interval E-value
HlyIII pfam03006
Haemolysin-III related; Members of this family are integral membrane proteins. This family ...
138-361 3.37e-54

Haemolysin-III related; Members of this family are integral membrane proteins. This family includes a protein with hemolytic activity from Bacillus cereus. It has been proposed that YOL002c encodes a Saccharomyces cerevisiae protein that plays a key role in metabolic pathways that regulate lipid and phosphate metabolizm. In eukaryotes, members are seven-transmembrane pass molecules found to encode functional receptors with a broad range of apparent ligand specificities, including progestin and adipoQ receptors, and hence have been named PAQR proteins. The mammalian members include progesterone binding proteins. Unlike the case with GPCR receptor proteins, the evolutionary ancestry of the members of this family can be traced back to the Archaea.


Pssm-ID: 251670  Cd Length: 207  Bit Score: 179.76  E-value: 3.37e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025  138 FRIHTETGNIWTHLLGFVLFLFLGVLTMLRPNMYFmaPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSE-KVSRTFSKL 216
Cdd:pfam03006   1 FSLHNETANIWTHLLGAILFIVLLIFLLVLASLGG--SPWAVVPFSIYGLSLFLLLLVSTLYHLFSCHSEgRVKYILRKL 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025  217 DYSGIALLIMGSFVPWLYYSFycSPQPRLIYLSIVCVLGISAIIVAQWDRfstPKHRPTRAGVFLGLGLSGIVPTLHFti 296
Cdd:pfam03006  79 DHSGIYLLIAGSYTPFLLYAL--CGPLGWILLIFIWGLALLGILLKLFPL---KRFRWLRTVLYLLMGWLGIIPIKHL-- 151
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 147899025  297 aegfVKATTVGQMGWFFLMAVMYITGAGLYAARiperfFPGKFDIWFQSHQIFHVLVVAAAFIHL 361
Cdd:pfam03006 152 ----ILALGGGGLVLLVLGGVLYTLGAIFYALR-----FPGPFDIWGHSHQIFHLFVVLGALCHY 207
COG1272 COG1272
Predicted membrane protein, hemolysin III homolog [General function prediction only]
114-364 8.95e-30

Predicted membrane protein, hemolysin III homolog [General function prediction only]


Pssm-ID: 224191  Cd Length: 226  Bit Score: 114.64  E-value: 8.95e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025 114 KDNDYLLHGHRPPMPSFracfrsifriHTETGNIWTHLLGFVLFLFLGvlTMLRPNMYFMAPLQEKVVFGMFFLGAVLCL 193
Cdd:COG1272    2 RDNNYIAEGKRSKSYSW----------HEEIANAITHLIGAILAIVGL--VLLLVYALITGSALAVIVFSIYGLSLFLLF 69
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025 194 SFSWLFHTVYcHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCspQPRLIYLSIVCVLGISAIIVAQwdrFSTPKHR 273
Cdd:COG1272   70 LVSTLYHSIP-NGQKAKAILRKFDHSGIYVLIAGSYTPFLLVGLYG--PLGWILLGLIWGLALAGILFKL---FFKKRFR 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025 274 PTRAGVFLGLGLSGIVPTLHFTIAEGFVKATtvgqmgWFFLMAVMYITGAGLYAARIperffpgkfDIWFQSHQIFHVLV 353
Cdd:COG1272  144 KLSLVLYLAMGWLGLIVIKPLIAKLGLIGLV------LLALGGVLYSVGAIFYVLRI---------DRIPYSHAIWHLFV 208
                        250
                 ....*....|.
gi 147899025 354 VAAAFIHLYGI 364
Cdd:COG1272  209 VGGAACHFIAI 219
Hypothetical_UPF0073_protein_yqfA. TIGR01065
channel protein, hemolysin III family; This family includes proteins from pathogenic and ...
178-364 9.82e-11

channel protein, hemolysin III family; This family includes proteins from pathogenic and non-pathogenic bacteria, Homo sapiens and Drosophila. In Bacillus cereus, a pathogen, it has been show to function as a channel-forming cytolysin. The human protein is expressed preferentially in mature macrophages, consistent with a role cytolytic role.


Pssm-ID: 273425  Cd Length: 204  Bit Score: 59.65  E-value: 9.82e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025  178 EKVVFGMFFLGAVLCLSFSWLFHTVyCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYcSPQPRLIyLSIVCVLGIS 257
Cdd:TIGR01065  35 AVLGFSIYGISLILLFLVSTLYHSI-PKGSKAKNWLRKIDHSMIYVLIAGTYTPFLLLALP-GPLGWTV-LWIIWGLAIG 111
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025  258 AIIVAQwdrfsTPKHRPTRAGVFL----GLGLSGIVPTLhftiaegfVKATTVGQMGWFFLMAVMYITGAGLYAARIPer 333
Cdd:TIGR01065 112 GIIYKL-----FFHKRPRWLSLFLylimGWLVVLVIKPL--------YHNLPGAGFSLLAAGGLLYTVGAIFYALKWP-- 176
                         170       180       190
                  ....*....|....*....|....*....|.
gi 147899025  334 ffpgkfdIWFQSHQIFHVLVVAAAFIHLYGI 364
Cdd:TIGR01065 177 -------IPFTYHAIWHLFVLGASACHFVAI 200
 
Name Accession Description Interval E-value
HlyIII pfam03006
Haemolysin-III related; Members of this family are integral membrane proteins. This family ...
138-361 3.37e-54

Haemolysin-III related; Members of this family are integral membrane proteins. This family includes a protein with hemolytic activity from Bacillus cereus. It has been proposed that YOL002c encodes a Saccharomyces cerevisiae protein that plays a key role in metabolic pathways that regulate lipid and phosphate metabolizm. In eukaryotes, members are seven-transmembrane pass molecules found to encode functional receptors with a broad range of apparent ligand specificities, including progestin and adipoQ receptors, and hence have been named PAQR proteins. The mammalian members include progesterone binding proteins. Unlike the case with GPCR receptor proteins, the evolutionary ancestry of the members of this family can be traced back to the Archaea.


Pssm-ID: 251670  Cd Length: 207  Bit Score: 179.76  E-value: 3.37e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025  138 FRIHTETGNIWTHLLGFVLFLFLGVLTMLRPNMYFmaPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSE-KVSRTFSKL 216
Cdd:pfam03006   1 FSLHNETANIWTHLLGAILFIVLLIFLLVLASLGG--SPWAVVPFSIYGLSLFLLLLVSTLYHLFSCHSEgRVKYILRKL 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025  217 DYSGIALLIMGSFVPWLYYSFycSPQPRLIYLSIVCVLGISAIIVAQWDRfstPKHRPTRAGVFLGLGLSGIVPTLHFti 296
Cdd:pfam03006  79 DHSGIYLLIAGSYTPFLLYAL--CGPLGWILLIFIWGLALLGILLKLFPL---KRFRWLRTVLYLLMGWLGIIPIKHL-- 151
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 147899025  297 aegfVKATTVGQMGWFFLMAVMYITGAGLYAARiperfFPGKFDIWFQSHQIFHVLVVAAAFIHL 361
Cdd:pfam03006 152 ----ILALGGGGLVLLVLGGVLYTLGAIFYALR-----FPGPFDIWGHSHQIFHLFVVLGALCHY 207
COG1272 COG1272
Predicted membrane protein, hemolysin III homolog [General function prediction only]
114-364 8.95e-30

Predicted membrane protein, hemolysin III homolog [General function prediction only]


Pssm-ID: 224191  Cd Length: 226  Bit Score: 114.64  E-value: 8.95e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025 114 KDNDYLLHGHRPPMPSFracfrsifriHTETGNIWTHLLGFVLFLFLGvlTMLRPNMYFMAPLQEKVVFGMFFLGAVLCL 193
Cdd:COG1272    2 RDNNYIAEGKRSKSYSW----------HEEIANAITHLIGAILAIVGL--VLLLVYALITGSALAVIVFSIYGLSLFLLF 69
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025 194 SFSWLFHTVYcHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCspQPRLIYLSIVCVLGISAIIVAQwdrFSTPKHR 273
Cdd:COG1272   70 LVSTLYHSIP-NGQKAKAILRKFDHSGIYVLIAGSYTPFLLVGLYG--PLGWILLGLIWGLALAGILFKL---FFKKRFR 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025 274 PTRAGVFLGLGLSGIVPTLHFTIAEGFVKATtvgqmgWFFLMAVMYITGAGLYAARIperffpgkfDIWFQSHQIFHVLV 353
Cdd:COG1272  144 KLSLVLYLAMGWLGLIVIKPLIAKLGLIGLV------LLALGGVLYSVGAIFYVLRI---------DRIPYSHAIWHLFV 208
                        250
                 ....*....|.
gi 147899025 354 VAAAFIHLYGI 364
Cdd:COG1272  209 VGGAACHFIAI 219
Hypothetical_UPF0073_protein_yqfA. TIGR01065
channel protein, hemolysin III family; This family includes proteins from pathogenic and ...
178-364 9.82e-11

channel protein, hemolysin III family; This family includes proteins from pathogenic and non-pathogenic bacteria, Homo sapiens and Drosophila. In Bacillus cereus, a pathogen, it has been show to function as a channel-forming cytolysin. The human protein is expressed preferentially in mature macrophages, consistent with a role cytolytic role.


Pssm-ID: 273425  Cd Length: 204  Bit Score: 59.65  E-value: 9.82e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025  178 EKVVFGMFFLGAVLCLSFSWLFHTVyCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYcSPQPRLIyLSIVCVLGIS 257
Cdd:TIGR01065  35 AVLGFSIYGISLILLFLVSTLYHSI-PKGSKAKNWLRKIDHSMIYVLIAGTYTPFLLLALP-GPLGWTV-LWIIWGLAIG 111
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899025  258 AIIVAQwdrfsTPKHRPTRAGVFL----GLGLSGIVPTLhftiaegfVKATTVGQMGWFFLMAVMYITGAGLYAARIPer 333
Cdd:TIGR01065 112 GIIYKL-----FFHKRPRWLSLFLylimGWLVVLVIKPL--------YHNLPGAGFSLLAAGGLLYTVGAIFYALKWP-- 176
                         170       180       190
                  ....*....|....*....|....*....|.
gi 147899025  334 ffpgkfdIWFQSHQIFHVLVVAAAFIHLYGI 364
Cdd:TIGR01065 177 -------IPFTYHAIWHLFVLGASACHFVAI 200
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH