NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|146306958|ref|YP_001187423|]
View 

response regulator receiver protein [Pseudomonas mendocina ymp]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
9-122 5.80e-34

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


:

Pssm-ID: 238088  Cd Length: 113  Bit Score: 123.07  E-value: 5.80e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   9 LIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAGV 88
Cdd:cd00156    1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHGD 80
                         90       100       110
                 ....*....|....*....|....*....|....
gi 146306958  89 MNDAVEALRLGAADYLIKPLeDLAVLEHSVRRAL 122
Cdd:cd00156   81 DEDAVEALKAGADDYLTKPF-SPEELLARIRALL 113
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
200-392 1.47e-30

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 115.85  E-value: 1.47e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  200 DERRIGFYLADVSGHGASSAFVTVLLKFMTTRLLYEwrrggslpEFKPSDVLGHINRGLI-NCKLGKHVTMLGGVIDEQS 278
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALE--------GLDPAEVLERLNRALQrNLEGERFATAVLAVYDPET 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  279 GQLTYSIGGHLPlPVLF--ENGEARYLEGRGLPVGLFAEAEYGDQVMKLPESFSLTLLSDGILDLL-PGETLKEKE---- 351
Cdd:pfam07228  73 GTLEYANAGHPP-PLLLrpDGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARdPDGELFGLErlla 151
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 146306958  352 LALPQLVSQAGGTLDGLRQVLGLANLGEMPDDIALLVLSRN 392
Cdd:pfam07228 152 LLAERHGLSPEELLDALLEDLLRLGGGELEDDITLLVLRVR 192
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
93-393 2.88e-42

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


:

Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 152.94  E-value: 2.88e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  93 VEALRLGAADYLIKPLEDLAVLEHSVRRALDRsrlRMENQRYREKLEAANRELQASLHLLQEDQNAGRQVQMNMLPVTPW 172
Cdd:COG2208   68 PVEVLLGVSGKLRALSEEIKHWRGGLPLVAEL---LVEINRAVGLVSAHNELLLLEQNNISAELEVARQIQQNLLPKALP 144
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958 173 QVDGLTFAHKIIPSLYLSGDFVDYFRIDERRIGFYLADVSGHGASSAFVTVLLKFMTTRLLyewrrggSLPEFKPSDVLG 252
Cdd:COG2208  145 LFPGIDIEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLL-------ESGPLDPADVLE 217
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958 253 HINRGLINCK-LGKHVTMLGGVIDEQSGQLTYSIGGHLPLPVLFENGEA--RYLEGRGLPVGLFAEAEYGDQVMKLPESF 329
Cdd:COG2208  218 TLNRVLKQNLeEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEIevEDLTALGLPIGLLPDYQYEVASLQLEPGD 297
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958 330 SLTLLSDGILDLLPGETLKEKELALPQLV------SQAGGTLDGLRQVLGLANLGEMPDDIALLVLSRNL 393
Cdd:COG2208  298 LLVLYTDGVTEARNSDGEFFGLERLLKILgrllgqPAEEILEAILESLEELQGDQIQDDDITLLVLKVKK 367
 
Name Accession Description Interval E-value
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
9-122 5.80e-34

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 123.07  E-value: 5.80e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   9 LIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAGV 88
Cdd:cd00156    1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHGD 80
                         90       100       110
                 ....*....|....*....|....*....|....
gi 146306958  89 MNDAVEALRLGAADYLIKPLeDLAVLEHSVRRAL 122
Cdd:cd00156   81 DEDAVEALKAGADDYLTKPF-SPEELLARIRALL 113
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
8-119 1.32e-33

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 249561  Cd Length: 111  Bit Score: 121.91  E-value: 1.32e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958    8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAG 87
Cdd:pfam00072   1 VLIVDDDPLIRELLRQLLEKEGYVVAEADDGEEALELLKEKRPDLILLDIRMPGMDGLELLRRIRRRPPTTPVIVLTAHG 80
                          90       100       110
                  ....*....|....*....|....*....|..
gi 146306958   88 VMNDAVEALRLGAADYLIKPlEDLAVLEHSVR 119
Cdd:pfam00072  81 DEEDAVEALKAGANDFLSKP-FDPEELLAALR 111
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
200-392 1.47e-30

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 115.85  E-value: 1.47e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  200 DERRIGFYLADVSGHGASSAFVTVLLKFMTTRLLYEwrrggslpEFKPSDVLGHINRGLI-NCKLGKHVTMLGGVIDEQS 278
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALE--------GLDPAEVLERLNRALQrNLEGERFATAVLAVYDPET 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  279 GQLTYSIGGHLPlPVLF--ENGEARYLEGRGLPVGLFAEAEYGDQVMKLPESFSLTLLSDGILDLL-PGETLKEKE---- 351
Cdd:pfam07228  73 GTLEYANAGHPP-PLLLrpDGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARdPDGELFGLErlla 151
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 146306958  352 LALPQLVSQAGGTLDGLRQVLGLANLGEMPDDIALLVLSRN 392
Cdd:pfam07228 152 LLAERHGLSPEELLDALLEDLLRLGGGELEDDITLLVLRVR 192
CheY COG0784
FOG: CheY-like receiver [Signal transduction mechanisms]
1-128 6.41e-27

FOG: CheY-like receiver [Signal transduction mechanisms]


Pssm-ID: 223855  Cd Length: 130  Bit Score: 103.77  E-value: 6.41e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKTSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNG-LQGLEVFQQES-PDLMICDLRMPQVDGLELIRRINALGVEV 78
Cdd:COG0784    1 LLLSGLRVLVVDDEPVNRRLLKRLLEDLGYEVVEAADGeEEALELLRELPqPDLILLDINMPGMDGIELLRRLRARGPNI 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 146306958  79 PVIVVSGAGVMNDAVEALRLGAADYLIKPLEDLAVLEHSVRRALDRSRLR 128
Cdd:COG0784   81 PVILLTAYADEADRERALAAGADDYLTKPIFLEEELLAALRRLLARAAAE 130
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
174-361 2.57e-14

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 70.07  E-value: 2.57e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   174 VDGLTFAHKIIPSLYLSGDFVDYFRIDERRIGFYLADVSGHGASSAFVTVLLKFMttrLLYEWRRGGSlpefkPSDVLGH 253
Cdd:smart00331   1 DDGGLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSA---LRTLLSEGIS-----LSQILER 72
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   254 INR---GLINCklGKHVTMLGGVIDEQSGQLTYSIGGHlPLPVLF--ENGEARYLEGRGLPVGLFAEAEYGDQVMKLPES 328
Cdd:smart00331  73 LNRaiyENGED--GMFATLFLALYDFAGGTLSYANAGH-SPPYLLraDGGLVEDLDDLGAPLGLEPDVEVDVRELTLEPG 149
                          170       180       190
                   ....*....|....*....|....*....|...
gi 146306958   329 FSLTLLSDGILDLLPGETLKEKELALPQLVSQA 361
Cdd:smart00331 150 DLLLLYTDGLTEARNPERLEELLEELLGSPPAE 182
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
7-60 2.72e-13

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 64.13  E-value: 2.72e-13
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 146306958     7 TLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMP 60
Cdd:smart00448   2 RILVVDDDPLLRELLKALLEKEGYEVDEATDGEEALELLKEEKPDLILLDIMMP 55
PRK10610 PRK10610
chemotaxis regulatory protein CheY; Provisional
1-124 2.75e-11

chemotaxis regulatory protein CheY; Provisional


Pssm-ID: 170568  Cd Length: 129  Bit Score: 60.37  E-value: 2.75e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKTSATLLIIDDDDVVRASLAAYLEDSGF-KVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALG--VE 77
Cdd:PRK10610   1 MADKELKFLVVDDFSTMRRIVRNLLKELGFnNVEEAEDGVDALNKLQAGGFGFVISDWNMPNMDGLELLKTIRADGamSA 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 146306958  78 VPVIVVSGAGVMNDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDR 124
Cdd:PRK10610  81 LPVLMVTAEAKKENIIAAAQAGASGYVVKPFT-AATLEEKLNKIFEK 126
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
93-393 2.88e-42

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 152.94  E-value: 2.88e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  93 VEALRLGAADYLIKPLEDLAVLEHSVRRALDRsrlRMENQRYREKLEAANRELQASLHLLQEDQNAGRQVQMNMLPVTPW 172
Cdd:COG2208   68 PVEVLLGVSGKLRALSEEIKHWRGGLPLVAEL---LVEINRAVGLVSAHNELLLLEQNNISAELEVARQIQQNLLPKALP 144
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958 173 QVDGLTFAHKIIPSLYLSGDFVDYFRIDERRIGFYLADVSGHGASSAFVTVLLKFMTTRLLyewrrggSLPEFKPSDVLG 252
Cdd:COG2208  145 LFPGIDIEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLL-------ESGPLDPADVLE 217
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958 253 HINRGLINCK-LGKHVTMLGGVIDEQSGQLTYSIGGHLPLPVLFENGEA--RYLEGRGLPVGLFAEAEYGDQVMKLPESF 329
Cdd:COG2208  218 TLNRVLKQNLeEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEIevEDLTALGLPIGLLPDYQYEVASLQLEPGD 297
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958 330 SLTLLSDGILDLLPGETLKEKELALPQLV------SQAGGTLDGLRQVLGLANLGEMPDDIALLVLSRNL 393
Cdd:COG2208  298 LLVLYTDGVTEARNSDGEFFGLERLLKILgrllgqPAEEILEAILESLEELQGDQIQDDDITLLVLKVKK 367
AtoC COG2204
Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains ...
3-145 1.28e-36

Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]


Pssm-ID: 225114 [Multi-domain]  Cd Length: 464  Bit Score: 138.60  E-value: 1.28e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   3 KTSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIV 82
Cdd:COG2204    2 MMMARILVVDDDPDIRELLEQALELAGYEVVTAESAEEALEALSESPFDLVLLDIRMPGMDGLELLKEIKSRDPDLPVIV 81
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 146306958  83 VSGAGVMNDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRSRLRMENQRYREKLEAANREL 145
Cdd:COG2204   82 MTGHGDIDTAVEALRLGAFDFLEKPF-DLDRLLAIVERALELRELQRENRRSLKRAKSLGGEL 143
PRK11361 PRK11361
acetoacetate metabolism regulatory protein AtoC; Provisional
3-140 1.81e-26

acetoacetate metabolism regulatory protein AtoC; Provisional


Pssm-ID: 183099 [Multi-domain]  Cd Length: 457  Bit Score: 108.78  E-value: 1.81e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   3 KTSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIV 82
Cdd:PRK11361   2 TAINRILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGIKALKEMRSHETRTPVIL 81
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 146306958  83 VSGAGVMNDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRSRLRMENQRYREKLEA 140
Cdd:PRK11361  82 MTAYAEVETAVEALRCGAFDYVIKPF-DLDELNLIVQRALQLQSMKKEIRHLHQALST 138
PRK10693 PRK10693
response regulator of RpoS; Provisional
34-258 3.53e-25

response regulator of RpoS; Provisional


Pssm-ID: 182652 [Multi-domain]  Cd Length: 303  Bit Score: 103.15  E-value: 3.53e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  34 QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAGVMNDAVEALRLGAADYLIKPLEDLAV 113
Cdd:PRK10693   2 LAANGVDALELLGGFTPDLIICDLAMPRMNGIEFVEHLRNRGDQTPVLVISATENMADIAKALRLGVQDVLLKPVKDLNR 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958 114 LEHSVRRALD----RSRLRMENQRYREkLEAANRELQASLHLLQEDQNAGRQVQMNmLPVTPWQvdgLTFAHKiiPSLYL 189
Cdd:PRK10693  82 LREMVFACLYpsmfNSRVEEEERLFRD-WDALVDNPAAAAKLLKQLQPPVQQVIAH-CRVNYRQ---LVAADK--PGLVL 154
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 146306958 190 sgdfvDYFRIDERRIGFYLADVSGHGASSAFVTVLLKFMTTRLLYEW--RRGGSLPEFkpSDVLGHINRGL 258
Cdd:PRK10693 155 -----DIAALSDNDLAFYCLDVTRAGDNGVLAALLLRALFNGLLQEQlaHQNQRLPEL--GALLKQVNHLL 218
orf27 CHL00148
Ycf27; Reviewed
1-137 1.19e-19

Ycf27; Reviewed


Pssm-ID: 214376 [Multi-domain]  Cd Length: 240  Bit Score: 85.92  E-value: 1.19e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKTSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGvEVPV 80
Cdd:CHL00148   2 MENSKEKILVVDDEAYIRKILETRLSIIGYEVITASDGEEALKLFRKEQPDLVILDVMMPKLDGYGVCQEIRKES-DVPI 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 146306958  81 IVVSGAGVMNDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDRSRLRMENQRYREK 137
Cdd:CHL00148  81 IMLTALGDVSDRITGLELGADDYVVKPFS-PKELEARIRSVLRRTNKKSFSSKIPNS 136
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
5-121 2.44e-17

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].


Pssm-ID: 131209 [Multi-domain]  Cd Length: 226  Bit Score: 79.29  E-value: 2.44e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958    5 SATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRI--NALGVEVPVIV 82
Cdd:TIGR02154   2 TRRILVVEDEPAIRELIAYNLEKAGYDVVEAGDGDEALTLINERGPDLILLDWMLPGTSGIELCRRLrrRPETRAIPIIM 81
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 146306958   83 VSGAGVMNDAVEALRLGAADYLIKPL---EDLAVLEHSVRRA 121
Cdd:TIGR02154  82 LTARGEEEDRVRGLETGADDYITKPFsprELLARIKAVLRRI 123
PLN03029 PLN03029
type-a response regulator protein; Provisional
8-165 7.15e-08

type-a response regulator protein; Provisional


Pssm-ID: 215544 [Multi-domain]  Cd Length: 222  Bit Score: 51.57  E-value: 7.15e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVF-----QQESPD---------------LMICDLRMPQVDGLEL 67
Cdd:PLN03029  11 VLAVDDSLIDRKLIEKLLKTSSYQVTTVDSGSKALKFLglhedDRSNPDtpsvspnshqevevnLIITDYCMPGMTGYDL 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  68 IRRINALGV--EVPVIVVSGAGVMNDAVEALRLGAADYLIKP--LEDLAVLEHSVRRALDRSRlRMENQRYREKLEAANR 143
Cdd:PLN03029  91 LKKIKESSSlrNIPVVIMSSENVPSRITRCLEEGAEEFFLKPvqLSDLNRLKPHMMKTKSKNQ-KQENQEKQEKLEESEI 169
                        170       180
                 ....*....|....*....|....*.
gi 146306958 144 EL----QASLHLLQEDQNAGRQVQMN 165
Cdd:PLN03029 170 QSekqeQPSQQPQSQPQPQQQPQQPN 195
 
Name Accession Description Interval E-value
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
9-122 5.80e-34

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 123.07  E-value: 5.80e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   9 LIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAGV 88
Cdd:cd00156    1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHGD 80
                         90       100       110
                 ....*....|....*....|....*....|....
gi 146306958  89 MNDAVEALRLGAADYLIKPLeDLAVLEHSVRRAL 122
Cdd:cd00156   81 DEDAVEALKAGADDYLTKPF-SPEELLARIRALL 113
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
8-119 1.32e-33

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 249561  Cd Length: 111  Bit Score: 121.91  E-value: 1.32e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958    8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAG 87
Cdd:pfam00072   1 VLIVDDDPLIRELLRQLLEKEGYVVAEADDGEEALELLKEKRPDLILLDIRMPGMDGLELLRRIRRRPPTTPVIVLTAHG 80
                          90       100       110
                  ....*....|....*....|....*....|..
gi 146306958   88 VMNDAVEALRLGAADYLIKPlEDLAVLEHSVR 119
Cdd:pfam00072  81 DEEDAVEALKAGANDFLSKP-FDPEELLAALR 111
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
200-392 1.47e-30

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 115.85  E-value: 1.47e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  200 DERRIGFYLADVSGHGASSAFVTVLLKFMTTRLLYEwrrggslpEFKPSDVLGHINRGLI-NCKLGKHVTMLGGVIDEQS 278
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALE--------GLDPAEVLERLNRALQrNLEGERFATAVLAVYDPET 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  279 GQLTYSIGGHLPlPVLF--ENGEARYLEGRGLPVGLFAEAEYGDQVMKLPESFSLTLLSDGILDLL-PGETLKEKE---- 351
Cdd:pfam07228  73 GTLEYANAGHPP-PLLLrpDGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARdPDGELFGLErlla 151
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 146306958  352 LALPQLVSQAGGTLDGLRQVLGLANLGEMPDDIALLVLSRN 392
Cdd:pfam07228 152 LLAERHGLSPEELLDALLEDLLRLGGGELEDDITLLVLRVR 192
CheY COG0784
FOG: CheY-like receiver [Signal transduction mechanisms]
1-128 6.41e-27

FOG: CheY-like receiver [Signal transduction mechanisms]


Pssm-ID: 223855  Cd Length: 130  Bit Score: 103.77  E-value: 6.41e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKTSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNG-LQGLEVFQQES-PDLMICDLRMPQVDGLELIRRINALGVEV 78
Cdd:COG0784    1 LLLSGLRVLVVDDEPVNRRLLKRLLEDLGYEVVEAADGeEEALELLRELPqPDLILLDINMPGMDGIELLRRLRARGPNI 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 146306958  79 PVIVVSGAGVMNDAVEALRLGAADYLIKPLEDLAVLEHSVRRALDRSRLR 128
Cdd:COG0784   81 PVILLTAYADEADRERALAAGADDYLTKPIFLEEELLAALRRLLARAAAE 130
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
174-361 2.57e-14

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 70.07  E-value: 2.57e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   174 VDGLTFAHKIIPSLYLSGDFVDYFRIDERRIGFYLADVSGHGASSAFVTVLLKFMttrLLYEWRRGGSlpefkPSDVLGH 253
Cdd:smart00331   1 DDGGLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSA---LRTLLSEGIS-----LSQILER 72
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   254 INR---GLINCklGKHVTMLGGVIDEQSGQLTYSIGGHlPLPVLF--ENGEARYLEGRGLPVGLFAEAEYGDQVMKLPES 328
Cdd:smart00331  73 LNRaiyENGED--GMFATLFLALYDFAGGTLSYANAGH-SPPYLLraDGGLVEDLDDLGAPLGLEPDVEVDVRELTLEPG 149
                          170       180       190
                   ....*....|....*....|....*....|...
gi 146306958   329 FSLTLLSDGILDLLPGETLKEKELALPQLVSQA 361
Cdd:smart00331 150 DLLLLYTDGLTEARNPERLEELLEELLGSPPAE 182
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
7-60 2.72e-13

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 64.13  E-value: 2.72e-13
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 146306958     7 TLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMP 60
Cdd:smart00448   2 RILVVDDDPLLRELLKALLEKEGYEVDEATDGEEALELLKEEKPDLILLDIMMP 55
PRK10610 PRK10610
chemotaxis regulatory protein CheY; Provisional
1-124 2.75e-11

chemotaxis regulatory protein CheY; Provisional


Pssm-ID: 170568  Cd Length: 129  Bit Score: 60.37  E-value: 2.75e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKTSATLLIIDDDDVVRASLAAYLEDSGF-KVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALG--VE 77
Cdd:PRK10610   1 MADKELKFLVVDDFSTMRRIVRNLLKELGFnNVEEAEDGVDALNKLQAGGFGFVISDWNMPNMDGLELLKTIRADGamSA 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 146306958  78 VPVIVVSGAGVMNDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDR 124
Cdd:PRK10610  81 LPVLMVTAEAKKENIIAAAQAGASGYVVKPFT-AATLEEKLNKIFEK 126
HisF cd04731
The cyclase subunit of imidazoleglycerol phosphate synthase (HisF). Imidazole glycerol ...
65-102 7.71e-04

The cyclase subunit of imidazoleglycerol phosphate synthase (HisF). Imidazole glycerol phosphate synthase (IGPS) catalyzes the fifth step of histidine biosynthesis, the formation of the imidazole ring. IGPS converts N1-(5'-phosphoribulosyl)-formimino-5-aminoimidazole-4-carboxamide ribonucleotide (PRFAR) to imidazole glycerol phosphate (ImGP) and 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR). This conversion involves two tightly coupled reactions in distinct active sites of IGPS. The two catalytic domains can be fused, like in fungi and plants, or peformed by a heterodimer (HisH-glutaminase and HisF-cyclase), like in bacteria.


Pssm-ID: 240082  Cd Length: 243  Bit Score: 39.37  E-value: 7.71e-04
                         10        20        30
                 ....*....|....*....|....*....|....*...
gi 146306958  65 LELIRRINALgVEVPVIVVSGAGVMNDAVEALRLGAAD 102
Cdd:cd04731  182 LELIRAVSSA-VNIPVIASGGAGKPEHFVEAFEEGGAD 218
HisF COG0107
Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]
65-102 7.93e-04

Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]


Pssm-ID: 223185  Cd Length: 256  Bit Score: 39.46  E-value: 7.93e-04
                         10        20        30
                 ....*....|....*....|....*....|....*...
gi 146306958  65 LELIRRINALgVEVPVIVVSGAGVMNDAVEALRLGAAD 102
Cdd:COG0107  188 LELTRAVREA-VNIPVIASGGAGKPEHFVEAFTEGKAD 224
PRK02083 PRK02083
imidazole glycerol phosphate synthase subunit HisF; Provisional
65-102 8.47e-04

imidazole glycerol phosphate synthase subunit HisF; Provisional


Pssm-ID: 234996  Cd Length: 253  Bit Score: 39.28  E-value: 8.47e-04
                         10        20        30
                 ....*....|....*....|....*....|....*...
gi 146306958  65 LELIRRINALgVEVPVIVVSGAGVMNDAVEALRLGAAD 102
Cdd:PRK02083 186 LELTRAVSDA-VNVPVIASGGAGNLEHFVEAFTEGGAD 222
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
93-393 2.88e-42

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 152.94  E-value: 2.88e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  93 VEALRLGAADYLIKPLEDLAVLEHSVRRALDRsrlRMENQRYREKLEAANRELQASLHLLQEDQNAGRQVQMNMLPVTPW 172
Cdd:COG2208   68 PVEVLLGVSGKLRALSEEIKHWRGGLPLVAEL---LVEINRAVGLVSAHNELLLLEQNNISAELEVARQIQQNLLPKALP 144
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958 173 QVDGLTFAHKIIPSLYLSGDFVDYFRIDERRIGFYLADVSGHGASSAFVTVLLKFMTTRLLyewrrggSLPEFKPSDVLG 252
Cdd:COG2208  145 LFPGIDIEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLL-------ESGPLDPADVLE 217
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958 253 HINRGLINCK-LGKHVTMLGGVIDEQSGQLTYSIGGHLPLPVLFENGEA--RYLEGRGLPVGLFAEAEYGDQVMKLPESF 329
Cdd:COG2208  218 TLNRVLKQNLeEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEIevEDLTALGLPIGLLPDYQYEVASLQLEPGD 297
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958 330 SLTLLSDGILDLLPGETLKEKELALPQLV------SQAGGTLDGLRQVLGLANLGEMPDDIALLVLSRNL 393
Cdd:COG2208  298 LLVLYTDGVTEARNSDGEFFGLERLLKILgrllgqPAEEILEAILESLEELQGDQIQDDDITLLVLKVKK 367
AtoC COG2204
Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains ...
3-145 1.28e-36

Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]


Pssm-ID: 225114 [Multi-domain]  Cd Length: 464  Bit Score: 138.60  E-value: 1.28e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   3 KTSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIV 82
Cdd:COG2204    2 MMMARILVVDDDPDIRELLEQALELAGYEVVTAESAEEALEALSESPFDLVLLDIRMPGMDGLELLKEIKSRDPDLPVIV 81
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 146306958  83 VSGAGVMNDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRSRLRMENQRYREKLEAANREL 145
Cdd:COG2204   82 MTGHGDIDTAVEALRLGAFDFLEKPF-DLDRLLAIVERALELRELQRENRRSLKRAKSLGGEL 143
PRK11361 PRK11361
acetoacetate metabolism regulatory protein AtoC; Provisional
3-140 1.81e-26

acetoacetate metabolism regulatory protein AtoC; Provisional


Pssm-ID: 183099 [Multi-domain]  Cd Length: 457  Bit Score: 108.78  E-value: 1.81e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   3 KTSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIV 82
Cdd:PRK11361   2 TAINRILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGIKALKEMRSHETRTPVIL 81
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 146306958  83 VSGAGVMNDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRSRLRMENQRYREKLEA 140
Cdd:PRK11361  82 MTAYAEVETAVEALRCGAFDYVIKPF-DLDELNLIVQRALQLQSMKKEIRHLHQALST 138
TtrR COG4566
Response regulator [Signal transduction mechanisms]
4-149 3.26e-25

Response regulator [Signal transduction mechanisms]


Pssm-ID: 226932 [Multi-domain]  Cd Length: 202  Bit Score: 101.21  E-value: 3.26e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   4 TSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVV 83
Cdd:COG4566    3 REPLVHVVDDDESVRDALAFLLESAGFQVKCFASAEEFLAAAPLDRPGCLLLDVRMPGMSGLELQDRLAERGIRLPVIFL 82
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 146306958  84 SGAGVMNDAVEALRLGAADYLIKPLEDLAVLEhSVRRALDRSRLRmenqRYREKLEAANRELQASL 149
Cdd:COG4566   83 TGHGDIPMAVQAMKAGAVDFLEKPFSEQDLLD-AVERALARDASR----RAEADRQAAIRARLATL 143
PRK10693 PRK10693
response regulator of RpoS; Provisional
34-258 3.53e-25

response regulator of RpoS; Provisional


Pssm-ID: 182652 [Multi-domain]  Cd Length: 303  Bit Score: 103.15  E-value: 3.53e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  34 QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAGVMNDAVEALRLGAADYLIKPLEDLAV 113
Cdd:PRK10693   2 LAANGVDALELLGGFTPDLIICDLAMPRMNGIEFVEHLRNRGDQTPVLVISATENMADIAKALRLGVQDVLLKPVKDLNR 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958 114 LEHSVRRALD----RSRLRMENQRYREkLEAANRELQASLHLLQEDQNAGRQVQMNmLPVTPWQvdgLTFAHKiiPSLYL 189
Cdd:PRK10693  82 LREMVFACLYpsmfNSRVEEEERLFRD-WDALVDNPAAAAKLLKQLQPPVQQVIAH-CRVNYRQ---LVAADK--PGLVL 154
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 146306958 190 sgdfvDYFRIDERRIGFYLADVSGHGASSAFVTVLLKFMTTRLLYEW--RRGGSLPEFkpSDVLGHINRGL 258
Cdd:PRK10693 155 -----DIAALSDNDLAFYCLDVTRAGDNGVLAALLLRALFNGLLQEQlaHQNQRLPEL--GALLKQVNHLL 218
COG4753 COG4753
Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain ...
7-139 5.46e-25

Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms]


Pssm-ID: 227095 [Multi-domain]  Cd Length: 475  Bit Score: 104.75  E-value: 5.46e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   7 TLLIIDDDDVVRASLAAYLEDS--GFKVLQ-ANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVV 83
Cdd:COG4753    3 KVLIVDDEPLIREGLKSLIDWEalGIEVVGtAANGKEALELIQETQPDIVITDINMPGMDGLDLIKAIKEQSPDTEFIIL 82
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 146306958  84 SGAGVMNDAVEALRLGAADYLIKPL--EDL-AVLEHsVRRALDRSRLrmENQRYREKLE 139
Cdd:COG4753   83 SGYDEFEYAKKAMKLGVKDYLLKPVdkAELeEALKK-IIGKLEEQQK--VKQDIEKLLT 138
fixJ PRK09390
response regulator FixJ; Provisional
4-126 2.43e-24

response regulator FixJ; Provisional


Pssm-ID: 181815 [Multi-domain]  Cd Length: 202  Bit Score: 98.54  E-value: 2.43e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   4 TSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVV 83
Cdd:PRK09390   2 DKGVVHVVDDDEAMRDSLAFLLDSAGFEVRLFESAQAFLDALPGLRFGCVVTDVRMPGIDGIELLRRLKARGSPLPVIVM 81
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 146306958  84 SGAGVMNDAVEALRLGAADYLIKPLEDLAVLEhSVRRALDRSR 126
Cdd:PRK09390  82 TGHGDVPLAVEAMKLGAVDFIEKPFEDERLIG-AIERALAQAP 123
OmpR COG0745
Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding ...
8-133 2.55e-23

Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]


Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 96.21  E-value: 2.55e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQEsPDLMICDLRMPQVDGLELIRRINAL-GVEVPVIVVSGA 86
Cdd:COG0745    3 ILLVEDDPELAELLKEYLEEEGYEVDVAADGEEALEAAREQ-PDLVLLDLMLPDLDGLELCRRLRAKkGSGPPIIVLTAR 81
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 146306958  87 GVMNDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRSRLRMENQR 133
Cdd:COG0745   82 DDEEDRVLGLEAGADDYLTKPF-SPRELLARLRALLRRNAGASRAEA 127
PRK10365 PRK10365
transcriptional regulatory protein ZraR; Provisional
1-126 1.47e-21

transcriptional regulatory protein ZraR; Provisional


Pssm-ID: 182412 [Multi-domain]  Cd Length: 441  Bit Score: 94.33  E-value: 1.47e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKTSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPV 80
Cdd:PRK10365   1 MTHDNIDILVVDDDISHCTILQALLRGWGYNVALANSGRQALEQVREQVFDLVLCDVRMAEMDGIATLKEIKALNPAIPV 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 146306958  81 IVVSGAGVMNDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRSR 126
Cdd:PRK10365  81 LIMTAYSSVETAVEALKTGALDYLIKPL-DFDNLQATLEKALAHTH 125
PleD COG3706
Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal ...
1-148 7.81e-21

Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms]


Pssm-ID: 226229 [Multi-domain]  Cd Length: 435  Bit Score: 92.39  E-value: 7.81e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKTSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRI--NALGVEV 78
Cdd:COG3706  128 PEDAPKKILVVDDDATQRERLRRILQVEGFRVVEATDGEEALLQLAELPPDLVLLDANMPDMDGLELCTRLrqLERTRDI 207
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  79 PVIVVSGAGVMNDAVEALRLGAADYLIKPLEDlAVLEHSVRRALDRSrlrmenqRYREKLEAANRELQAS 148
Cdd:COG3706  208 PIILLSSKDDDELVVRAFELGVNDYITKPIEE-GELRARLRRQLRRK-------RYERQLRESLERLQEL 269
COG3437 COG3437
Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription ...
1-160 9.08e-21

Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms]


Pssm-ID: 225971 [Multi-domain]  Cd Length: 360  Bit Score: 91.27  E-value: 9.08e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKTSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLEL---IRRINALGVE 77
Cdd:COG3437   10 EPDEKLTVLLVDDEPDNLEALRQLLRMIGYRVIEAENGEEALKLLQEEPPDLVLLDVRMPEMDGAEVlnkLKAMSPSTRR 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  78 VPVIVVSGAGVMNDAVEALRLGAADYLIKPledlavlehsVRRALDRSRLRMENQRYREKLEAANR----ELQASLHLLQ 153
Cdd:COG3437   90 IPVILLTAYADSEDRQRALEAGADDYLSKP----------ISPKELVARVSSHLQLKRNEDFLLDQnlylELQELRRRTE 159

                 ....*..
gi 146306958 154 EDQNAGR 160
Cdd:COG3437  160 ELAQIED 166
CitB COG2197
Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain ...
8-126 2.33e-20

Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]


Pssm-ID: 225107 [Multi-domain]  Cd Length: 211  Bit Score: 87.74  E-value: 2.33e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLE-DSGFKVL-QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSG 85
Cdd:COG2197    3 VLIVDDHPLVREGLRQLLElEPDLEVVgEASNGEEALDLARELKPDVVLLDLSMPGMDGLEALKQLRARGPDIKVVVLTA 82
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 146306958  86 AGVMNDAVEALRLGAADYLIKPlEDLAVLEHSVRRALDRSR 126
Cdd:COG2197   83 HDDPAYVIRALRAGADGYLLKD-ASPEELVEAIRAVAAGGT 122
CitB COG4565
Response regulator of citrate/malate metabolism [Transcription / Signal transduction ...
7-160 4.00e-20

Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms]


Pssm-ID: 226931 [Multi-domain]  Cd Length: 224  Bit Score: 87.31  E-value: 4.00e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   7 TLLIIDDDDVVRASLAAYLED-SGFK-VLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVS 84
Cdd:COG4565    2 NVLIIEDDPMVAEIHRRYVKQiPGFSvVGTAGTLEEAKMIIEEFKPDLILLDIYMPDGNGIELLPELRSQHYPVDVIVIT 81
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 146306958  85 GAGVMNDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDRSRLRMENQryreklEAANRELQASLHLLQEDQNAGR 160
Cdd:COG4565   82 AASDMETIKEALRYGVVDYLIKPFT-FERLQQALTRYRQKRHALESHQ------QLSQKELDQLFNIQSKEQPPDD 150
orf27 CHL00148
Ycf27; Reviewed
1-137 1.19e-19

Ycf27; Reviewed


Pssm-ID: 214376 [Multi-domain]  Cd Length: 240  Bit Score: 85.92  E-value: 1.19e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKTSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGvEVPV 80
Cdd:CHL00148   2 MENSKEKILVVDDEAYIRKILETRLSIIGYEVITASDGEEALKLFRKEQPDLVILDVMMPKLDGYGVCQEIRKES-DVPI 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 146306958  81 IVVSGAGVMNDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDRSRLRMENQRYREK 137
Cdd:CHL00148  81 IMLTALGDVSDRITGLELGADDYVVKPFS-PKELEARIRSVLRRTNKKSFSSKIPNS 136
COG4567 COG4567
Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal ...
1-107 8.94e-18

Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription]


Pssm-ID: 226933 [Multi-domain]  Cd Length: 182  Bit Score: 79.77  E-value: 8.94e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKTSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPV 80
Cdd:COG4567    5 MIGPDKSLLLVDDDTPFLRTLARAMERRGFAVVTAESVEEALAAARTAPPAYAVVDLKLGDGSGLAVIEALRERRADMRI 84
                         90       100
                 ....*....|....*....|....*..
gi 146306958  81 IVVSGAGVMNDAVEALRLGAADYLIKP 107
Cdd:COG4567   85 VVLTGYASIATAVEAVKLGACDYLAKP 111
PRK15115 PRK15115
response regulator GlrR; Provisional
1-109 1.30e-17

response regulator GlrR; Provisional


Pssm-ID: 185070 [Multi-domain]  Cd Length: 444  Bit Score: 82.96  E-value: 1.30e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKTSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPV 80
Cdd:PRK15115   1 MSRKPAHLLLVDDDPGLLKLLGMRLTSEGYSVVTAESGQEALRVLNREKVDLVISDLRMDEMDGMQLFAEIQKVQPGMPV 80
                         90       100
                 ....*....|....*....|....*....
gi 146306958  81 IVVSGAGVMNDAVEALRLGAADYLIKPLE 109
Cdd:PRK15115  81 IILTAHGSIPDAVAATQQGVFSFLTKPVD 109
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
5-121 2.44e-17

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].


Pssm-ID: 131209 [Multi-domain]  Cd Length: 226  Bit Score: 79.29  E-value: 2.44e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958    5 SATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRI--NALGVEVPVIV 82
Cdd:TIGR02154   2 TRRILVVEDEPAIRELIAYNLEKAGYDVVEAGDGDEALTLINERGPDLILLDWMLPGTSGIELCRRLrrRPETRAIPIIM 81
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 146306958   83 VSGAGVMNDAVEALRLGAADYLIKPL---EDLAVLEHSVRRA 121
Cdd:TIGR02154  82 LTARGEEEDRVRGLETGADDYITKPFsprELLARIKAVLRRI 123
ompR PRK09468
osmolarity response regulator; Provisional
8-120 1.23e-16

osmolarity response regulator; Provisional


Pssm-ID: 181883 [Multi-domain]  Cd Length: 239  Bit Score: 77.32  E-value: 1.23e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAG 87
Cdd:PRK09468   8 ILVVDDDMRLRALLERYLTEQGFQVRSAANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQNNPTPIIMLTAKG 87
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 146306958  88 VMNDAVEALRLGAADYLIKPL---EDLAVLEHSVRR 120
Cdd:PRK09468  88 EEVDRIVGLEIGADDYLPKPFnprELLARIRAVLRR 123
PRK10766 PRK10766
DNA-binding transcriptional regulator TorR; Provisional
5-109 1.58e-16

DNA-binding transcriptional regulator TorR; Provisional


Pssm-ID: 182711 [Multi-domain]  Cd Length: 221  Bit Score: 77.00  E-value: 1.58e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   5 SATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGvEVPVIVVS 84
Cdd:PRK10766   2 SYHILVVEDEPVTRARLQGYFEQEGYTVSEAASGAGMREIMQNQHVDLILLDINLPGEDGLMLTRELRSRS-TVGIILVT 80
                         90       100
                 ....*....|....*....|....*
gi 146306958  85 GAGVMNDAVEALRLGAADYLIKPLE 109
Cdd:PRK10766  81 GRTDSIDRIVGLEMGADDYVTKPLE 105
ntrC TIGR01818
nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response ...
8-122 2.39e-16

nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response regulator that is phosphorylated by NtrB and interacts with sigma-54. NtrC usually controls the expression of glutamine synthase, GlnA, and may be called GlnL, GlnG, etc [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, DNA interactions, Signal transduction, Two-component systems].


Pssm-ID: 233585 [Multi-domain]  Cd Length: 463  Bit Score: 79.01  E-value: 2.39e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958    8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAG 87
Cdd:TIGR01818   1 VWVVDDDRSIRWVLEKALSRAGYEVRTFGNAASVLRALARGQPDLLITDVRMPGEDGLDLLPQIKKRHPQLPVIVMTAHS 80
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 146306958   88 VMNDAVEALRLGAADYLIKPLeDLAVLEHSVRRAL 122
Cdd:TIGR01818  81 DLDTAVAAYQRGAFEYLPKPF-DLDEAVTLVERAL 114
PRK10651 PRK10651
transcriptional regulator NarL; Provisional
1-116 2.49e-16

transcriptional regulator NarL; Provisional


Pssm-ID: 182619 [Multi-domain]  Cd Length: 216  Bit Score: 76.22  E-value: 2.49e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKTSATLLIIDDDDVVRASLAAYLE-DSGFKVL-QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEV 78
Cdd:PRK10651   2 SNQEPATILLIDDHPMLRTGVKQLISmAPDITVVgEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREKSLSG 81
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 146306958  79 PVIVVSGAGVMNDAVEALRLGAADYLIKPLEDLAVLEH 116
Cdd:PRK10651  82 RIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKA 119
cztR_silR_copR TIGR01387
heavy metal response regulator; Members of this family contain a response regulator receiver ...
8-152 6.04e-15

heavy metal response regulator; Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system.


Pssm-ID: 130454 [Multi-domain]  Cd Length: 218  Bit Score: 72.14  E-value: 6.04e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958    8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAG 87
Cdd:TIGR01387   1 ILVVEDEQKTAEYLQQGLSESGYVVDAASNGRDGLHLALKDDYDLIILDVMLPGMDGWQILQTLRRSGKQTPVLFLTARD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   88 VMNDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRSR-----------LRMENQRYR-----EKLEAANRELQAsLHL 151
Cdd:TIGR01387  81 SVADKVKGLDLGADDYLVKPF-SFSELLARVRTLLRRSHslnstvleiadLRMDSVRHRvsrgnIRITLTRKEFQL-LWL 158

                  .
gi 146306958  152 L 152
Cdd:TIGR01387 159 L 159
PRK10336 PRK10336
DNA-binding transcriptional regulator QseB; Provisional
8-126 6.64e-15

DNA-binding transcriptional regulator QseB; Provisional


Pssm-ID: 182387 [Multi-domain]  Cd Length: 219  Bit Score: 72.24  E-value: 6.64e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAG 87
Cdd:PRK10336   3 ILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGQREPVLILTARD 82
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 146306958  88 VMNDAVEALRLGAADYLIKP---LEDLAVLEHSVRRALDRSR 126
Cdd:PRK10336  83 ALAERVEGLRLGADDYLCKPfalIEVAARLEALMRRTNGQAS 124
PRK09836 PRK09836
DNA-binding transcriptional activator CusR; Provisional
8-124 1.34e-14

DNA-binding transcriptional activator CusR; Provisional


Pssm-ID: 182102 [Multi-domain]  Cd Length: 227  Bit Score: 71.49  E-value: 1.34e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAG 87
Cdd:PRK09836   3 LLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTALG 82
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 146306958  88 VMNDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDR 124
Cdd:PRK09836  83 TIEHRVKGLELGADDYLVKPFA-FAELLARVRTLLRR 118
PRK10529 PRK10529
DNA-binding transcriptional activator KdpE; Provisional
6-120 2.51e-14

DNA-binding transcriptional activator KdpE; Provisional


Pssm-ID: 182522 [Multi-domain]  Cd Length: 225  Bit Score: 70.60  E-value: 2.51e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   6 ATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVeVPVIVVSG 85
Cdd:PRK10529   2 TNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQWSA-IPVIVLSA 80
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 146306958  86 AGVMNDAVEALRLGAADYLIKPL---EDLAVLEHSVRR 120
Cdd:PRK10529  81 RSEESDKIAALDAGADDYLSKPFgigELQARLRVALRR 118
PRK15479 PRK15479
transcriptional regulatory protein TctD; Provisional
8-134 2.52e-14

transcriptional regulatory protein TctD; Provisional


Pssm-ID: 185376 [Multi-domain]  Cd Length: 221  Bit Score: 70.52  E-value: 2.52e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAG 87
Cdd:PRK15479   3 LLLAEDNRELAHWLEKALVQNGFAVDCVFDGLAADHLLQSEMYALAVLDINMPGMDGLEVLQRLRKRGQTLPVLLLTARS 82
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 146306958  88 VMNDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDRSR-LRMENQRY 134
Cdd:PRK15479  83 AVADRVKGLNVGADDYLPKPFE-LEELDARLRALLRRSAgQVQEVQQL 129
glnG PRK10923
nitrogen regulation protein NR(I); Provisional
10-128 3.40e-14

nitrogen regulation protein NR(I); Provisional


Pssm-ID: 182842 [Multi-domain]  Cd Length: 469  Bit Score: 72.60  E-value: 3.40e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  10 IIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAGVM 89
Cdd:PRK10923   8 VVDDDSSIRWVLERALAGAGLTCTTFENGNEVLEALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDL 87
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 146306958  90 NDAVEALRLGAADYLIKPL---EDLAVLEHSVRRALDRSRLR 128
Cdd:PRK10923  88 DAAVSAYQQGAFDYLPKPFdidEAVALVERAISHYQEQQQPR 129
PRK00742 PRK00742
chemotaxis-specific methylesterase; Provisional
9-129 2.46e-13

chemotaxis-specific methylesterase; Provisional


Pssm-ID: 234828 [Multi-domain]  Cd Length: 354  Bit Score: 69.41  E-value: 2.46e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   9 LIIDDDDVVRASLAAYLE-DSGFKVL-QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALgVEVPVIVVS-- 84
Cdd:PRK00742   7 LVVDDSAFMRRLISEILNsDPDIEVVgTAPDGLEAREKIKKLNPDVITLDVEMPVMDGLDALEKIMRL-RPTPVVMVSsl 85
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 146306958  85 ---GAGVmndAVEALRLGAADYLIKPLEDLAVLEHSVR-------RALDRSRLRM 129
Cdd:PRK00742  86 terGAEI---TLRALELGAVDFVTKPFLGISLGMDEYKeelaekvRAAARARVRA 137
PRK10643 PRK10643
DNA-binding transcriptional regulator BasR; Provisional
8-132 3.94e-13

DNA-binding transcriptional regulator BasR; Provisional


Pssm-ID: 182612 [Multi-domain]  Cd Length: 222  Bit Score: 66.98  E-value: 3.94e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAG 87
Cdd:PRK10643   3 ILIVEDDTLLLQGLILALQTEGYACDCASTAREAEALLESGHYSLVVLDLGLPDEDGLHLLRRWRQKKYTLPVLILTARD 82
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 146306958  88 VMNDAVEALRLGAADYLIKP--LEDLavleHSVRRALDRsrlRMENQ 132
Cdd:PRK10643  83 TLEDRVAGLDVGADDYLVKPfaLEEL----HARIRALIR---RHQGQ 122
PRK10955 PRK10955
DNA-binding transcriptional regulator CpxR; Provisional
1-132 5.12e-13

DNA-binding transcriptional regulator CpxR; Provisional


Pssm-ID: 182864 [Multi-domain]  Cd Length: 232  Bit Score: 66.75  E-value: 5.12e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKtsatLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQqESPDLMICDLRMPQVDGLELIRRINaLGVEVPV 80
Cdd:PRK10955   1 MNK----ILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLD-DSIDLLLLDVMMPKKNGIDTLKELR-QTHQTPV 74
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 146306958  81 IVVSGAGVMNDAVEALRLGAADYLIKPLEDLAVLEHsVRRALDRSRLRMENQ 132
Cdd:PRK10955  75 IMLTARGSELDRVLGLELGADDYLPKPFNDRELVAR-IRAILRRSHWSEQQQ 125
spore_0_A TIGR02875
sporulation transcription factor Spo0A; Spo0A, the stage 0 sporulation protein A, is a ...
8-120 7.81e-13

sporulation transcription factor Spo0A; Spo0A, the stage 0 sporulation protein A, is a transcription factor critical for the initiation of sporulation. It contains a response regulator receiver domain (pfam00072). In Bacillus subtilis, it works together with response regulator Spo0F and the phosphotransferase Spo0B, both of which are missing from at least some sporulating species and thus not part of the endospore forming bacteria minimal gene set. Spo0A, however, is universal among endospore-forming species [Cellular processes, Sporulation and germination].


Pssm-ID: 131922 [Multi-domain]  Cd Length: 262  Bit Score: 66.74  E-value: 7.81e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958    8 LLIIDDDDVVRASLAAYL--EDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRIN--ALGVEVPVIVV 83
Cdd:TIGR02875   5 IVIADDNKEFCNLLKEYLaaQPDMEVVGVAHNGVDALELIKEQQPDVVVLDIIMPHLDGIGVLEKLNeiELSARPRVIML 84
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 146306958   84 SGAGVMNDAVEALRLGAADYLIKPLeDLAVLEHSVRR 120
Cdd:TIGR02875  85 SAFGQEKITQRAVALGADYYVLKPF-DLEILAARIRQ 120
PRK13856 PRK13856
two-component response regulator VirG; Provisional
8-146 9.87e-13

two-component response regulator VirG; Provisional


Pssm-ID: 172377 [Multi-domain]  Cd Length: 241  Bit Score: 65.99  E-value: 9.87e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRInALGVEVPVIVVSGAG 87
Cdd:PRK13856   4 VLVIDDDVAMRHLIVEYLTIHAFKVTAVADSQQFNRVLASETVDVVVVDLNLGREDGLEIVRSL-ATKSDVPIIIISGDR 82
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 146306958  88 VMN-DAVEALRLGAADYLIKPL---EDLAVLEHSVR------RALDRSRLR----MENQRYREKLEAANRELQ 146
Cdd:PRK13856  83 LEEaDKVVALELGATDFIAKPFgtrEFLARIRVALRvrpnvvRTKDRRSFCfadwTLNLRQRRLISEAGGEVK 155
pleD PRK09581
response regulator PleD; Reviewed
5-136 1.05e-12

response regulator PleD; Reviewed


Pssm-ID: 236577 [Multi-domain]  Cd Length: 457  Bit Score: 68.00  E-value: 1.05e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   5 SATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRI--NALGVEVPVIV 82
Cdd:PRK09581   2 TARILVVDDIPANVKLLEAKLLAEYYTVLTASSGAEAIAICEREQPDIILLDVMMPGMDGFEVCRRLksDPATTHIPVVM 81
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  83 VSGAGVMNDAVEALRLGAADYLIKPLEDLAVLehsVR-RALDRSR-----LRMENQRYRE 136
Cdd:PRK09581  82 VTALDDPEDRVRGLEAGADDFLTKPINDVALF---ARvKSLTRLKmvideLRLRASTNAE 138
CheB COG2201
Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase ...
6-113 1.66e-12

Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 225111 [Multi-domain]  Cd Length: 350  Bit Score: 66.93  E-value: 1.66e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   6 ATLLIIDDDDVVRASLAAYLEDSG--FKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALgVEVPVIVV 83
Cdd:COG2201    2 IRVLVVDDSALMRKVISDILNSDPdiEVVGTARNGREAIDKVKKLKPDVITLDVEMPVMDGLEALRKIMRL-RPLPVIMV 80
                         90       100       110
                 ....*....|....*....|....*....|..
gi 146306958  84 SGAGVMNDAV--EALRLGAADYLIKPLEDLAV 113
Cdd:COG2201   81 SSLTEEGAEAtlEALELGAVDFIAKPSGGISL 112
PRK10816 PRK10816
DNA-binding transcriptional regulator PhoP; Provisional
8-120 7.60e-12

DNA-binding transcriptional regulator PhoP; Provisional


Pssm-ID: 182755 [Multi-domain]  Cd Length: 223  Bit Score: 63.22  E-value: 7.60e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAG 87
Cdd:PRK10816   3 VLVVEDNALLRHHLKVQLQDAGHQVDAAEDAKEADYYLNEHLPDIAIVDLGLPDEDGLSLIRRWRSNDVSLPILVLTARE 82
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 146306958  88 VMNDAVEALRLGAADYLIKPL---EDLAVLEHSVRR 120
Cdd:PRK10816  83 SWQDKVEVLSAGADDYVTKPFhieEVMARMQALMRR 118
PRK11517 PRK11517
transcriptional regulatory protein YedW; Provisional
8-133 2.22e-11

transcriptional regulatory protein YedW; Provisional


Pssm-ID: 183172 [Multi-domain]  Cd Length: 223  Bit Score: 61.84  E-value: 2.22e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINAlGVEVPVIVVSGAG 87
Cdd:PRK11517   3 ILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGWQILQTLRT-AKQTPVICLTARD 81
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 146306958  88 VMNDAVEALRLGAADYLIKPL---EDLAVLEHSVRR------ALDRSRLRMENQR 133
Cdd:PRK11517  82 SVDDRVRGLDSGANDYLVKPFsfsELLARVRAQLRQhhalnsTLEISGLRMDSVS 136
PRK11083 PRK11083
DNA-binding response regulator CreB; Provisional
1-107 9.38e-11

DNA-binding response regulator CreB; Provisional


Pssm-ID: 236838 [Multi-domain]  Cd Length: 228  Bit Score: 59.98  E-value: 9.38e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKtsATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPV 80
Cdd:PRK11083   1 MQQ--PTILLVEDEQAIADTLVYALQSEGFTVEWFERGLPALDKLRQQPPDLVILDVGLPDISGFELCRQLLAFHPALPV 78
                         90       100
                 ....*....|....*....|....*..
gi 146306958  81 IVVSGAGVMNDAVEALRLGAADYLIKP 107
Cdd:PRK11083  79 IFLTARSDEVDRLVGLEIGADDYVAKP 105
PRK10161 PRK10161
transcriptional regulator PhoB; Provisional
8-120 1.07e-10

transcriptional regulator PhoB; Provisional


Pssm-ID: 182277 [Multi-domain]  Cd Length: 229  Bit Score: 59.73  E-value: 1.07e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRIN--ALGVEVPVIVVSG 85
Cdd:PRK10161   5 ILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKreSMTRDIPVVMLTA 84
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 146306958  86 AGVMNDAVEALRLGAADYLIKPL---EDLAVLEHSVRR 120
Cdd:PRK10161  85 RGEEEDRVRGLETGADDYITKPFspkELVARIKAVMRR 122
PEP_resp_reg TIGR02915
PEP-CTERM-box response regulator transcription factor; Members of this protein family share ...
8-135 2.28e-10

PEP-CTERM-box response regulator transcription factor; Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see SP|Q06065). These proteins have a Fis family DNA binding sequence (pfam02954), a response regulator receiver domain (pfam00072), and sigma-54 interaction domain (pfam00158) [Regulatory functions, DNA interactions].


Pssm-ID: 234057 [Multi-domain]  Cd Length: 445  Bit Score: 60.53  E-value: 2.28e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958    8 LLIIDDDDVVRASLAAYLEDsgFKVLQANNGLQGLEVFQQESPDLMICDLRMP-----QVDGLELIRRINALGVEVPVIV 82
Cdd:TIGR02915   1 LLIVEDDLGLQKQLKWSFAD--YELAVAADRESAIALVRRHEPAVVTLDLGLPpdadgASEGLAALQQILAIAPDTKVIV 78
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 146306958   83 VSGAGVMNDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRSRLRMENQRYR 135
Cdd:TIGR02915  79 ITGNDDRENAVKAIGLGAYDFYQKPI-DPDVLKLIVDRAFHLYTLETENRRLQ 130
PRK11697 PRK11697
putative two-component response-regulatory protein YehT; Provisional
7-120 2.97e-10

putative two-component response-regulatory protein YehT; Provisional


Pssm-ID: 236956 [Multi-domain]  Cd Length: 238  Bit Score: 58.70  E-value: 2.97e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   7 TLLIIDDDDVVRASLAAYLEDSG-FKVL-QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINAlgVEVPVIVVS 84
Cdd:PRK11697   3 KVLIVDDEPLAREELRELLQEEGdIEIVgECSNAIEAIGAIHRLKPDVVFLDIQMPRISGLELVGMLDP--EHMPYIVFV 80
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 146306958  85 GAgvmND--AVEALRLGAADYLIKPLEDlAVLEHSVRR 120
Cdd:PRK11697  81 TA---FDeyAIKAFEEHAFDYLLKPIDP-ARLAKTLAR 114
marine_sort_RR TIGR03787
proteobacterial dedicated sortase system response regulator; This model describes a family of ...
10-106 1.29e-09

proteobacterial dedicated sortase system response regulator; This model describes a family of DNA-binding response regulator proteins, associated with an adjacent histidine kinase (TIGR03785) to form a two-component system. This system co-occurs with, and often is adjacent to, a proteobacterial variant form of the protein sorting transpeptidase called sortase (TIGR03784), and a single target protein for the sortase. We give this protein the gene symbol pdsR, for Proteobacterial Dedicated Sortase system Response regulator.


Pssm-ID: 163499 [Multi-domain]  Cd Length: 227  Bit Score: 56.68  E-value: 1.29e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   10 IIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRM-PQVD-GLELIRRINALGVEVPVIVVSGAG 87
Cdd:TIGR03787   5 IVEDEAAIRENYADALKRQGYQVTTYADRPSAMQAFRQRLPDLAIIDIGLgEEIDgGFMLCQDLRSLSATLPIIFLTARD 84
                          90
                  ....*....|....*....
gi 146306958   88 VMNDAVEALRLGAADYLIK 106
Cdd:TIGR03787  85 SDFDTVSGLRLGADDYLTK 103
PRK11173 PRK11173
two-component response regulator; Provisional
8-107 1.40e-09

two-component response regulator; Provisional


Pssm-ID: 183013 [Multi-domain]  Cd Length: 237  Bit Score: 56.56  E-value: 1.40e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGvEVPVIVVSGAG 87
Cdd:PRK11173   6 ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSENDINLVIMDINLPGKNGLLLARELREQA-NVALMFLTGRD 84
                         90       100
                 ....*....|....*....|
gi 146306958  88 VMNDAVEALRLGAADYLIKP 107
Cdd:PRK11173  85 NEVDKILGLEIGADDYITKP 104
PRK09959 PRK09959
hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional
7-154 1.44e-09

hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional


Pssm-ID: 182169 [Multi-domain]  Cd Length: 1197  Bit Score: 58.59  E-value: 1.44e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958    7 TLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGA 86
Cdd:PRK09959  960 SILIADDHPTNRLLLKRQLNLLGYDVDEATDGVQALHKVSMQHYDLLITDVNMPNMDGFELTRKLREQNSSLPIWGLTAN 1039
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 146306958   87 GVMNDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDRSRLRmenQRYRE-KLEAANRELQASLHLLQE 154
Cdd:PRK09959 1040 AQANEREKGLSCGMNLCLFKPLT-LDVLKTHLSQLHQVAHIA---PQYRHlDIEALKNNTANDLQLMQE 1104
PRK10710 PRK10710
DNA-binding transcriptional regulator BaeR; Provisional
4-107 1.79e-09

DNA-binding transcriptional regulator BaeR; Provisional


Pssm-ID: 182665 [Multi-domain]  Cd Length: 240  Bit Score: 56.23  E-value: 1.79e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   4 TSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGvEVPVIVV 83
Cdd:PRK10710   9 NTPRILIVEDEPKLGQLLIDYLQAASYATTLLSHGDEVLPYVRQTPPDLILLDLMLPGTDGLTLCREIRRFS-DIPIVMV 87
                         90       100
                 ....*....|....*....|....
gi 146306958  84 SGAGVMNDAVEALRLGAADYLIKP 107
Cdd:PRK10710  88 TAKIEEIDRLLGLEIGADDYICKP 111
PRK15347 PRK15347
two component system sensor kinase SsrA; Provisional
9-155 2.96e-09

two component system sensor kinase SsrA; Provisional


Pssm-ID: 237951 [Multi-domain]  Cd Length: 921  Bit Score: 57.34  E-value: 2.96e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   9 LIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRR----INALGVEVPVIVVS 84
Cdd:PRK15347 694 LLVDDVETNRDIIGMMLVELGQQVTTAASGTEALELGRQHRFDLVLMDIRMPGLDGLETTQLwrddPNNLDPDCMIVALT 773
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 146306958  85 GAGVMNDAVEALRLGAADYLIKP--LEDLA-VLEHSVRRALDRSRLRMENQRYREKL-----EAANRELQASLHLLQED 155
Cdd:PRK15347 774 ANAAPEEIHRCKKAGMNHYLTKPvtLAQLArALELAAEYQLLRGIELSPQDSSCSPLldtddMALNSKLYQSLLLLLAQ 852
PRK10430 PRK10430
DNA-binding transcriptional activator DcuR; Provisional
9-109 3.23e-09

DNA-binding transcriptional activator DcuR; Provisional


Pssm-ID: 182454 [Multi-domain]  Cd Length: 239  Bit Score: 55.50  E-value: 3.23e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   9 LIIDDDDVVRASLAAYLED-SGFKVLQANNGLQGLE--VFQQESP-DLMICDLRMPQVDGLELIRRINALGVEVPVIVVS 84
Cdd:PRK10430   5 LIVDDDAMVAELNRRYVAQiPGFQCCGTASTLEQAKeiIFNSDTPiDLILLDIYMQQENGLDLLPVLHEAGCKSDVIVIS 84
                         90       100
                 ....*....|....*....|....*
gi 146306958  85 GAGVMNDAVEALRLGAADYLIKPLE 109
Cdd:PRK10430  85 SAADAATIKDSLHYGVVDYLIKPFQ 109
PRK10841 PRK10841
hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional
7-126 3.93e-09

hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional


Pssm-ID: 182772 [Multi-domain]  Cd Length: 924  Bit Score: 57.29  E-value: 3.93e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   7 TLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGA 86
Cdd:PRK10841 803 MILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLTDVNMPNMDGYRLTQRLRQLGLTLPVIGVTAN 882
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 146306958  87 GVMNDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDRSR 126
Cdd:PRK10841 883 ALAEEKQRCLEAGMDSCLSKPVT-LDVLKQTLTVYAERVR 921
PRK12555 PRK12555
chemotaxis-specific methylesterase; Provisional
9-107 9.11e-09

chemotaxis-specific methylesterase; Provisional


Pssm-ID: 237135 [Multi-domain]  Cd Length: 337  Bit Score: 55.27  E-value: 9.11e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   9 LIIDDDDVVRASLAAYLE-DSGFKVL-QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALgVEVPVIVVS-- 84
Cdd:PRK12555   4 GIVNDSPLAVEALRRALArDPDHEVVwVATDGAQAVERCAAQPPDVILMDLEMPRMDGVEATRRIMAE-RPCPILIVTsl 82
                         90       100
                 ....*....|....*....|....
gi 146306958  85 -GAGVMnDAVEALRLGAADYLIKP 107
Cdd:PRK12555  83 tERNAS-RVFEAMGAGALDAVDTP 105
PRK15369 PRK15369
two component system sensor kinase SsrB; Provisional
8-106 1.24e-08

two component system sensor kinase SsrB; Provisional


Pssm-ID: 185267 [Multi-domain]  Cd Length: 211  Bit Score: 53.54  E-value: 1.24e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDD----DVVRASLAAYLEdsgFKVL-QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIV 82
Cdd:PRK15369   6 ILLVDDHeliiNGIKNMLAPYPR---YKIVgQVDNGLEVYNACRQLEPDIVILDLGLPGMNGLDVIPQLHQRWPAMNILV 82
                         90       100
                 ....*....|....*....|....
gi 146306958  83 VSGAGVMNDAVEALRLGAADYLIK 106
Cdd:PRK15369  83 LTARQEEHMASRTLAAGALGYVLK 106
LytT COG3279
Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms]
9-113 2.45e-08

Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms]


Pssm-ID: 225818 [Multi-domain]  Cd Length: 244  Bit Score: 53.13  E-value: 2.45e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   9 LIIDDDDVVRASLAAYLEDSGF--KVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGA 86
Cdd:COG3279    5 LIVDDEPLAREELRRILNEIPDieIVGEAENGEEALQLLQGLRPDLVFLDIAMPDINGIELAARIRKGDPRPAIVFVTAH 84
                         90       100
                 ....*....|....*....|....*..
gi 146306958  87 GvmNDAVEALRLGAADYLIKPLEDLAV 113
Cdd:COG3279   85 D--EYAVAAFEVEALDYLLKPISEERL 109
AmiR COG3707
Response regulator with putative antiterminator output domain [Signal transduction mechanisms]
9-139 3.96e-08

Response regulator with putative antiterminator output domain [Signal transduction mechanisms]


Pssm-ID: 226230 [Multi-domain]  Cd Length: 194  Bit Score: 51.56  E-value: 3.96e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   9 LIIDDDDVVRASLAAYLEDSGFKVL-QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINAlGVEVPVIVV---S 84
Cdd:COG3707    9 LVADDEALTRMDIREGLLEAGYQRVgEAADGLEAVEVCERLQPDVVILDIEMPRRDIIEALLLASE-NVARPIVALtayS 87
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 146306958  85 GAGVMNDAVEAlrlGAADYLIKPLED---LAVLEHSVRRALDRSRLRMENQRYREKLE 139
Cdd:COG3707   88 DPALIEAAIEA---GVMAYIVKPLDEsrlLPILDVAVSRFEERRALRRELAKLKDRLE 142
COG3947 COG3947
Response regulator containing CheY-like receiver and SARP domains [Signal transduction ...
8-136 5.60e-08

Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms]


Pssm-ID: 226456 [Multi-domain]  Cd Length: 361  Bit Score: 52.94  E-value: 5.60e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVSGAG 87
Cdd:COG3947    3 IIIVDDDAAIVKLLSVILSRAGHEVRSCSHPVEALDLLEVFKPDLIFLDIVMPYMNGIEFAEQVRDIESAVPIIFISSHA 82
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*....
gi 146306958  88 vmNDAVEALRLGAADYLIKPledlaVLEHSVRRALDRSRLRMENQRYRE 136
Cdd:COG3947   83 --EYADDSFGMNLDDYLPKP-----VTPEKLNRAIDRRLKRVELTAEEE 124
PLN03029 PLN03029
type-a response regulator protein; Provisional
8-165 7.15e-08

type-a response regulator protein; Provisional


Pssm-ID: 215544 [Multi-domain]  Cd Length: 222  Bit Score: 51.57  E-value: 7.15e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   8 LLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVF-----QQESPD---------------LMICDLRMPQVDGLEL 67
Cdd:PLN03029  11 VLAVDDSLIDRKLIEKLLKTSSYQVTTVDSGSKALKFLglhedDRSNPDtpsvspnshqevevnLIITDYCMPGMTGYDL 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  68 IRRINALGV--EVPVIVVSGAGVMNDAVEALRLGAADYLIKP--LEDLAVLEHSVRRALDRSRlRMENQRYREKLEAANR 143
Cdd:PLN03029  91 LKKIKESSSlrNIPVVIMSSENVPSRITRCLEEGAEEFFLKPvqLSDLNRLKPHMMKTKSKNQ-KQENQEKQEKLEESEI 169
                        170       180
                 ....*....|....*....|....*.
gi 146306958 144 EL----QASLHLLQEDQNAGRQVQMN 165
Cdd:PLN03029 170 QSekqeQPSQQPQSQPQPQQQPQQPN 195
PRK09483 PRK09483
response regulator; Provisional
7-106 1.72e-07

response regulator; Provisional


Pssm-ID: 236538 [Multi-domain]  Cd Length: 217  Bit Score: 50.10  E-value: 1.72e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   7 TLLIIDDDDVVRASLAAYLED-SGFKVL-QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVS 84
Cdd:PRK09483   3 NVLLVDDHELVRAGIRRILEDiKGIKVVgEACCGEDAVKWCRTNAVDVVLMDMNMPGIGGLEATRKILRYTPDVKIIMLT 82
                         90       100
                 ....*....|....*....|....*....
gi 146306958  85 -------GAGVMndavealRLGAADYLIK 106
Cdd:PRK09483  83 vhtenplPAKVM-------QAGAAGYLSK 104
PRK10403 PRK10403
transcriptional regulator NarP; Provisional
3-115 1.92e-07

transcriptional regulator NarP; Provisional


Pssm-ID: 182431 [Multi-domain]  Cd Length: 215  Bit Score: 49.85  E-value: 1.92e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   3 KTSATLLIIDDDDVVRASLAAYLE-DSGFKVL-QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPV 80
Cdd:PRK10403   4 ATPFQVLIVDDHPLMRRGVRQLLElDPGFEVVaEAGDGASAIDLANRLDPDVILLDLNMKGMSGLDTLNALRRDGVTAQI 83
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 146306958  81 IVVSGAGVMNDAVEALRLGAADYLIKPLEDLAVLE 115
Cdd:PRK10403  84 IILTVSDASSDVFALIDAGADGYLLKDSDPEVLLE 118
dpiA PRK10046
two-component response regulator DpiA; Provisional
7-108 2.21e-07

two-component response regulator DpiA; Provisional


Pssm-ID: 182208 [Multi-domain]  Cd Length: 225  Bit Score: 50.02  E-value: 2.21e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   7 TLLIIDDDDVVRASLAAYLED-SGF-KVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVS 84
Cdd:PRK10046   6 TLLIVEDETPLAEMHAEYIRHiPGFsQILLAGNLAQARMMIERFKPGLILLDNYLPDGRGINLLHELVQAHYPGDVVFTT 85
                         90       100
                 ....*....|....*....|....
gi 146306958  85 GAGVMNDAVEALRLGAADYLIKPL 108
Cdd:PRK10046  86 AASDMETVSEAVRCGVFDYLIKPI 109
PleD COG3706
Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal ...
30-133 3.51e-07

Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms]


Pssm-ID: 226229 [Multi-domain]  Cd Length: 435  Bit Score: 50.40  E-value: 3.51e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  30 FKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALgvEVPVIVVSGAGVMNDAVEALRLGAADYLIKPLE 109
Cdd:COG3706   13 KEVATAKKGLIALAILLDHKPDYKLLDVMMPGMDGFELCRRLKAE--PATVVMVTALDDSAPRVRGLKAGADDFLTKPVN 90
                         90       100
                 ....*....|....*....|....*....
gi 146306958 110 DLAVLEHSV-----RRALDRSRLRMENQR 133
Cdd:COG3706   91 DSQLFLRAKslvrlKCSIDELRLREETGG 119
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
6-108 4.11e-07

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072) [Signal transduction, Two-component systems].


Pssm-ID: 234070 [Multi-domain]  Cd Length: 968  Bit Score: 50.93  E-value: 4.11e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958    6 ATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINAL---GVEVPVIV 82
Cdd:TIGR02956 703 QRVLLVEDNEVNQMVAQGFLTRLGHKVTLAESGQSALECFHQHAFDLALLDINLPDGDGVTLLQQLRAIygaKNEVKFIA 782
                          90       100
                  ....*....|....*....|....*..
gi 146306958   83 VSgAGVMNDAVEA-LRLGAADYLIKPL 108
Cdd:TIGR02956 783 FS-AHVFNEDVAQyLAAGFDGFLAKPV 808
PRK13557 PRK13557
histidine kinase; Provisional
5-123 1.75e-06

histidine kinase; Provisional


Pssm-ID: 237425 [Multi-domain]  Cd Length: 540  Bit Score: 48.51  E-value: 1.75e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   5 SATLLIIDD-DDVvrASLA-AYLEDSGFKVLQANNGLQGLEVFQQES-PDLMICDLRMP-QVDGLELIRRINALGVEVPV 80
Cdd:PRK13557 415 TETILIVDDrPDV--AELArMILEDFGYRTLVASNGREALEILDSHPeVDLLFTDLIMPgGMNGVMLAREARRRQPKIKV 492
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 146306958  81 IVVSGAGvmNDAVEALRLGAADYLI--KP--LEDLAvleHSVRRALD 123
Cdd:PRK13557 493 LLTTGYA--EASIERTDAGGSEFDIlnKPyrRAELA---RRVRMVLD 534
PRK14084 PRK14084
two-component response regulator; Provisional
9-125 1.84e-06

two-component response regulator; Provisional


Pssm-ID: 184495 [Multi-domain]  Cd Length: 246  Bit Score: 47.44  E-value: 1.84e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   9 LIIDDDDVVRASLAaYL--EDSGFKVL-QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGvEVPVIVVSG 85
Cdd:PRK14084   4 LIVDDEPLARNELT-YLlnEIGGFEEInEAENVKETLEALLINQYDIIFLDINLMDESGIELAAKIQKMK-EPPAIIFAT 81
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 146306958  86 AgvmND--AVEALRLGAADYLIKPLE----DLAVleHSVRRALDRS 125
Cdd:PRK14084  82 A---HDqfAVKAFELNATDYILKPFEqkriEQAV--NKVRATKAKD 122
PRK10701 PRK10701
DNA-binding transcriptional regulator RstA; Provisional
1-106 4.94e-06

DNA-binding transcriptional regulator RstA; Provisional


Pssm-ID: 236738 [Multi-domain]  Cd Length: 240  Bit Score: 46.17  E-value: 4.94e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   1 MHKtsatLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPV 80
Cdd:PRK10701   1 MNK----IVFVEDDAEVGSLIAAYLAKHDIDVTVEPRGDRAEATILREQPDLVLLDIMLPGKDGMTICRDLRPKWQGPIV 76
                         90       100
                 ....*....|....*....|....*.
gi 146306958  81 IVVSGAGVMNDaVEALRLGAADYLIK 106
Cdd:PRK10701  77 LLTSLDSDMNH-ILALEMGACDYILK 101
PRK09958 PRK09958
DNA-binding transcriptional activator EvgA; Provisional
7-84 9.35e-06

DNA-binding transcriptional activator EvgA; Provisional


Pssm-ID: 182168 [Multi-domain]  Cd Length: 204  Bit Score: 44.89  E-value: 9.35e-06
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 146306958   7 TLLIIDDDDVVRASLAAYLEDSGFKVL-QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVVS 84
Cdd:PRK09958   2 NAIIIDDHPLAIAAIRNLLIKNDIEILaELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVS 80
PRK11107 PRK11107
hybrid sensory histidine kinase BarA; Provisional
7-124 1.33e-05

hybrid sensory histidine kinase BarA; Provisional


Pssm-ID: 236848 [Multi-domain]  Cd Length: 919  Bit Score: 46.00  E-value: 1.33e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   7 TLLIIDDDDvvrASL---AAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGL---ELIRRiNALGVEVPV 80
Cdd:PRK11107 669 TVMAVDDNP---ANLkliGALLEEQVEHVVLCDSGHQAVEQAKQRPFDLILMDIQMPGMDGIracELIRQ-LPHNQNTPI 744
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 146306958  81 IVVSgAGVMNDAVEAL-RLGAADYLIKPLEdlavlEHSVRRALDR 124
Cdd:PRK11107 745 IAVT-AHAMAGERERLlSAGMDDYLAKPID-----EAMLKQVLLR 783
PRK09935 PRK09935
transcriptional regulator FimZ; Provisional
6-122 2.67e-05

transcriptional regulator FimZ; Provisional


Pssm-ID: 182154 [Multi-domain]  Cd Length: 210  Bit Score: 43.71  E-value: 2.67e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   6 ATLLIIDDDDVVRASLAAYLE-DSGFKV-LQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVV 83
Cdd:PRK09935   4 ASVIIMDTHPIIRMSIEVLLQkNSELQIvLKTDDYRITIDYLRTRPVDLIIMDIDLPGTDGFTFLKRIKQIQSTVKVLFL 83
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 146306958  84 SGAGVMNDAVEALRLGAADYLIKpLEDLAVLEHSVRRAL 122
Cdd:PRK09935  84 SSKSECFYAGRAIQAGANGFVSK-CNDQNDIFHAVQMIL 121
pleD PRK09581
response regulator PleD; Reviewed
4-129 4.73e-05

response regulator PleD; Reviewed


Pssm-ID: 236577 [Multi-domain]  Cd Length: 457  Bit Score: 43.74  E-value: 4.73e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   4 TSATLLIIDDDDVVRASLAAYLEDSgFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLEL--IRRINALGVEVPVI 81
Cdd:PRK09581 154 EDGRILLVDDDVSQAERIANILKEE-FRVVVVSDPSEALFNAAETNYDLVIVSANFENYDPLRLcsQLRSKERTRYVPIL 232
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 146306958  82 VVSGAGVMNDAVEALRLGAADYLIKPL---EDLAVLEHSVRRALDRSRLRM 129
Cdd:PRK09581 233 LLVDEDDDPRLVKALELGVNDYLMRPIdknELLARVRTQIRRKRYQDALRN 283
PRK10360 PRK10360
DNA-binding transcriptional activator UhpA; Provisional
7-106 8.67e-04

DNA-binding transcriptional activator UhpA; Provisional


Pssm-ID: 182408 [Multi-domain]  Cd Length: 196  Bit Score: 38.80  E-value: 8.67e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   7 TLLIIDDDDVVRASLAAYLE-DSGFKVL-QANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINAlGVEVPVIVVS 84
Cdd:PRK10360   3 TVALIDDHLIVRSGFAQLLGlEPDLQVVaEFGSGREALAGLPGRGVQVCICDISMPDISGLELLSQLPK-GMATIMLSVH 81
                         90       100
                 ....*....|....*....|..
gi 146306958  85 GAGVMNDavEALRLGAADYLIK 106
Cdd:PRK10360  82 DSPALVE--QALNAGARGFLSK 101
PRK11091 PRK11091
aerobic respiration control sensor protein ArcB; Provisional
25-108 1.33e-03

aerobic respiration control sensor protein ArcB; Provisional


Pssm-ID: 236842 [Multi-domain]  Cd Length: 779  Bit Score: 39.54  E-value: 1.33e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958  25 LEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINA--LGVEVPVIVVSGAGVMNDAVEALRLGAAD 102
Cdd:PRK11091 545 LEKLGNSVDVAMTGKEALEMFDPDEYDLVLLDIQLPDMTGLDIARELREryPREDLPPLVALTANVLKDKKEYLDAGMDD 624

                 ....*.
gi 146306958 103 YLIKPL 108
Cdd:PRK11091 625 VLSKPL 630
PRK13558 PRK13558
bacterio-opsin activator; Provisional
4-137 4.36e-03

bacterio-opsin activator; Provisional


Pssm-ID: 237426 [Multi-domain]  Cd Length: 665  Bit Score: 37.89  E-value: 4.36e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146306958   4 TSATLLIIDDDDVVRASLAAYLEDSGFKVLQANNGLQGLEVFQQESPDLMICDLRMPQVDGLELIRRINALGVEVPVIVV 83
Cdd:PRK13558   6 PTRGVLFVGDDPEAGPVDCDLDEDGRLDVTQIRDFVAARDRVEAGEIDCVVADHEPDGFDGLALLEAVRQTTAVPPVVVV 85
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 146306958  84 SGAGVMNDAVEALRLGAADYLIKPLEDL----------AVLEHS---VRRALDRSRLRMENQRYREK 137
Cdd:PRK13558  86 PTAGDEAVARRAVDADAAAYVPAVSDDAtaaiaeriesAVPEHSrdtEARMPISDLTVESDRRLKER 152
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH