NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|145334529|ref|NP_001078610.1|]
View 

translation initiation factor eIF-2 beta subunit [Arabidopsis thaliana]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
eIF2B_5 smart00653
domain present in translation initiation factor eIF2B and eIF5;
140-249 4.20e-67

domain present in translation initiation factor eIF2B and eIF5;


:

Pssm-ID: 214764  Cd Length: 110  Bit Score: 206.33  E-value: 4.20e-67
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529   140 RRRTVMRPPQVLREGTKKTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGSLDGQQRLVVKGRFAPKNFEGILRRYITDY 219
Cdd:smart00653   1 FYRFKMPPPQVLREGKGKTVIVNFADIAKALNRPPDHVLKFLLAELGTQGSIDGKGRLIVNGRFTPKKLQDLLRRYIKEY 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 145334529   220 VICLGCKSPDTILSKENRLFFLRCEKCGSQ 249
Cdd:smart00653  81 VLCPECGSPDTELIKENRLFFLKCEACGAR 110
 
Name Accession Description Interval E-value
eIF2B_5 smart00653
domain present in translation initiation factor eIF2B and eIF5;
140-249 4.20e-67

domain present in translation initiation factor eIF2B and eIF5;


Pssm-ID: 214764  Cd Length: 110  Bit Score: 206.33  E-value: 4.20e-67
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529   140 RRRTVMRPPQVLREGTKKTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGSLDGQQRLVVKGRFAPKNFEGILRRYITDY 219
Cdd:smart00653   1 FYRFKMPPPQVLREGKGKTVIVNFADIAKALNRPPDHVLKFLLAELGTQGSIDGKGRLIVNGRFTPKKLQDLLRRYIKEY 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 145334529   220 VICLGCKSPDTILSKENRLFFLRCEKCGSQ 249
Cdd:smart00653  81 VLCPECGSPDTELIKENRLFFLKCEACGAR 110
eIF-5_eIF-2B pfam01873
Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of ...
130-251 7.91e-63

Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of eIF-2 beta. This region corresponds to the whole of the archaebacterial eIF-2 beta homologue. The region contains a putative zinc binding C4 finger.


Pssm-ID: 250931  Cd Length: 125  Bit Score: 195.62  E-value: 7.91e-63
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529  130 RENNPE-LAGDRRRTVMRPPQVLREGTKKTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGSLDGQQRLVVKGRFAPKNF 208
Cdd:pfam01873   3 FNQNPDrVAGDKFRFEMPPPQVKIEGKIKTIIVNFSDIAKALNRPPEHLLKYLLAELGTQGSIDGKGRLIVNGRFTPKKL 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 145334529  209 EGILRRYITDYVICLGCKSPDTILSKENRLFFLRCEKCGSQRS 251
Cdd:pfam01873  83 QDVLDDYIKEYVLCHECKSPDTELIKENRLIFLKCKACGARRP 125
GCD7 COG1601
Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ...
112-264 3.53e-42

Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ribosomal structure and biogenesis]


Pssm-ID: 224517  Cd Length: 151  Bit Score: 143.27  E-value: 3.53e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529 112 SERDYIYDELLGRVFnilrENNPELAGDRR-RTVMRPPQVLREGtKKTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGS 190
Cdd:COG1601    2 SEMEDDYEELLERAY----SELPEKEVKNDeRFRIPEPEINREG-NRTIIRNFGDIAEALNRDPEHLVKFLKKELGTAGS 76
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 145334529 191 LDGQQRLVVKGRFAPKNFEGILRRYITDYVICLGCKSPDTILSKENRLFFLRCEKCGSQRSVAPIKTGFVARVS 264
Cdd:COG1601   77 IDGKGRLVLQGKFSDSEIVNEIERYIAEYVKCKECGSPDTELIKEERLLFLKCEACGAIRPVKLMKEYNLDFVS 150
PRK03988 PRK03988
translation initiation factor IF-2 subunit beta; Validated
112-255 7.56e-41

translation initiation factor IF-2 subunit beta; Validated


Pssm-ID: 235189  Cd Length: 138  Bit Score: 139.28  E-value: 7.56e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529 112 SERDYIYDELLGRVFNILrennPELAGDRRRTVMRPPQVLREGTKkTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGSL 191
Cdd:PRK03988   1 MSDYYDYEELLDRAYEKL----PEKVFKESRFEVPKPDVRIEGNR-TIIRNFKEIADRLNRDPKHVAKFLLKELGTAGNI 75
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 145334529 192 DGQqRLVVKGRFAPKNFEGILRRYITDYVICLGCKSPDTILSKENRLFFLRCEKCGSQRSVAPI 255
Cdd:PRK03988  76 EGG-RLILQGKFSPRVINEKIDRYVKEYVICPECGSPDTKLIKEGRIWVLKCEACGAETPVKPL 138
Translation_initiation_factor_2_subunit_beta TIGR00311
translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high ...
118-255 4.62e-24

translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high enough to select only archaeal members. The suggested cutoff is set to include most eukaryotic members but largely exclude the related eIF-5. [Protein synthesis, Translation factors]


Pssm-ID: 129411  Cd Length: 133  Bit Score: 94.53  E-value: 4.62e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529  118 YDELLGRVFNILrennPELAGDRRRTVMRPPQVLREGTKkTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGSLDGQqRL 197
Cdd:TIGR00311   2 YEKLLERAIDQL----PDEVFETKRFEVPKAYIVIEGNR-TIIQNFREVAKALNRDEQHLLKYLLKELGTAGNLEGG-RL 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 145334529  198 VVKGRFAPKNFEGILRRYITDYVICLGCKSPDTILSKENRLFFLRCEKCGSQRSVAPI 255
Cdd:TIGR00311  76 ILQGKFTHFLLNERIEDYVRKYVICRECNRPDTRIIKEGRVSLLKCEACGAKAPLRNI 133
PRK12336 PRK12336
translation initiation factor IF-2 subunit beta; Provisional
118-257 5.92e-39

translation initiation factor IF-2 subunit beta; Provisional


Pssm-ID: 183451 [Multi-domain]  Cd Length: 201  Bit Score: 136.23  E-value: 5.92e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529 118 YDELLGRVFNILrennPELAGDRRRTVMRPPQVLREGtKKTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGSLDGQqRL 197
Cdd:PRK12336   3 YESLLDRAMEVL----PEPTKSGERFSIPEPKIFIEG-KTTILTNFGEIADALNRDPDHLMKFLQRELGTAGKIEGG-RA 76
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529 198 VVKGRFAPKNFEGILRRYITDYVICLGCKSPDTILSKENRLFFLRCEKCGSQRSVAPIKT 257
Cdd:PRK12336  77 VFNGKFTEEDIQAAIDAYVDEYVICSECGLPDTRLVKEDRVLMLRCDACGAHRPVKKRKA 136
 
Name Accession Description Interval E-value
eIF2B_5 smart00653
domain present in translation initiation factor eIF2B and eIF5;
140-249 4.20e-67

domain present in translation initiation factor eIF2B and eIF5;


Pssm-ID: 214764  Cd Length: 110  Bit Score: 206.33  E-value: 4.20e-67
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529   140 RRRTVMRPPQVLREGTKKTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGSLDGQQRLVVKGRFAPKNFEGILRRYITDY 219
Cdd:smart00653   1 FYRFKMPPPQVLREGKGKTVIVNFADIAKALNRPPDHVLKFLLAELGTQGSIDGKGRLIVNGRFTPKKLQDLLRRYIKEY 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 145334529   220 VICLGCKSPDTILSKENRLFFLRCEKCGSQ 249
Cdd:smart00653  81 VLCPECGSPDTELIKENRLFFLKCEACGAR 110
eIF-5_eIF-2B pfam01873
Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of ...
130-251 7.91e-63

Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of eIF-2 beta. This region corresponds to the whole of the archaebacterial eIF-2 beta homologue. The region contains a putative zinc binding C4 finger.


Pssm-ID: 250931  Cd Length: 125  Bit Score: 195.62  E-value: 7.91e-63
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529  130 RENNPE-LAGDRRRTVMRPPQVLREGTKKTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGSLDGQQRLVVKGRFAPKNF 208
Cdd:pfam01873   3 FNQNPDrVAGDKFRFEMPPPQVKIEGKIKTIIVNFSDIAKALNRPPEHLLKYLLAELGTQGSIDGKGRLIVNGRFTPKKL 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 145334529  209 EGILRRYITDYVICLGCKSPDTILSKENRLFFLRCEKCGSQRS 251
Cdd:pfam01873  83 QDVLDDYIKEYVLCHECKSPDTELIKENRLIFLKCKACGARRP 125
GCD7 COG1601
Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ...
112-264 3.53e-42

Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ribosomal structure and biogenesis]


Pssm-ID: 224517  Cd Length: 151  Bit Score: 143.27  E-value: 3.53e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529 112 SERDYIYDELLGRVFnilrENNPELAGDRR-RTVMRPPQVLREGtKKTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGS 190
Cdd:COG1601    2 SEMEDDYEELLERAY----SELPEKEVKNDeRFRIPEPEINREG-NRTIIRNFGDIAEALNRDPEHLVKFLKKELGTAGS 76
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 145334529 191 LDGQQRLVVKGRFAPKNFEGILRRYITDYVICLGCKSPDTILSKENRLFFLRCEKCGSQRSVAPIKTGFVARVS 264
Cdd:COG1601   77 IDGKGRLVLQGKFSDSEIVNEIERYIAEYVKCKECGSPDTELIKEERLLFLKCEACGAIRPVKLMKEYNLDFVS 150
PRK03988 PRK03988
translation initiation factor IF-2 subunit beta; Validated
112-255 7.56e-41

translation initiation factor IF-2 subunit beta; Validated


Pssm-ID: 235189  Cd Length: 138  Bit Score: 139.28  E-value: 7.56e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529 112 SERDYIYDELLGRVFNILrennPELAGDRRRTVMRPPQVLREGTKkTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGSL 191
Cdd:PRK03988   1 MSDYYDYEELLDRAYEKL----PEKVFKESRFEVPKPDVRIEGNR-TIIRNFKEIADRLNRDPKHVAKFLLKELGTAGNI 75
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 145334529 192 DGQqRLVVKGRFAPKNFEGILRRYITDYVICLGCKSPDTILSKENRLFFLRCEKCGSQRSVAPI 255
Cdd:PRK03988  76 EGG-RLILQGKFSPRVINEKIDRYVKEYVICPECGSPDTKLIKEGRIWVLKCEACGAETPVKPL 138
Translation_initiation_factor_2_subunit_beta TIGR00311
translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high ...
118-255 4.62e-24

translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high enough to select only archaeal members. The suggested cutoff is set to include most eukaryotic members but largely exclude the related eIF-5. [Protein synthesis, Translation factors]


Pssm-ID: 129411  Cd Length: 133  Bit Score: 94.53  E-value: 4.62e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529  118 YDELLGRVFNILrennPELAGDRRRTVMRPPQVLREGTKkTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGSLDGQqRL 197
Cdd:TIGR00311   2 YEKLLERAIDQL----PDEVFETKRFEVPKAYIVIEGNR-TIIQNFREVAKALNRDEQHLLKYLLKELGTAGNLEGG-RL 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 145334529  198 VVKGRFAPKNFEGILRRYITDYVICLGCKSPDTILSKENRLFFLRCEKCGSQRSVAPI 255
Cdd:TIGR00311  76 ILQGKFTHFLLNERIEDYVRKYVICRECNRPDTRIIKEGRVSLLKCEACGAKAPLRNI 133
PRK12336 PRK12336
translation initiation factor IF-2 subunit beta; Provisional
118-257 5.92e-39

translation initiation factor IF-2 subunit beta; Provisional


Pssm-ID: 183451 [Multi-domain]  Cd Length: 201  Bit Score: 136.23  E-value: 5.92e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529 118 YDELLGRVFNILrennPELAGDRRRTVMRPPQVLREGtKKTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGSLDGQqRL 197
Cdd:PRK12336   3 YESLLDRAMEVL----PEPTKSGERFSIPEPKIFIEG-KTTILTNFGEIADALNRDPDHLMKFLQRELGTAGKIEGG-RA 76
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 145334529 198 VVKGRFAPKNFEGILRRYITDYVICLGCKSPDTILSKENRLFFLRCEKCGSQRSVAPIKT 257
Cdd:PRK12336  77 VFNGKFTEEDIQAAIDAYVDEYVICSECGLPDTRLVKEDRVLMLRCDACGAHRPVKKRKA 136
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH