NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|14327896|ref|NP_114172|]
View 

G2/mitotic-specific cyclin-B1 [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
201-290 4.12e-24

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


:

Pssm-ID: 238003  Cd Length: 88  Bit Score: 95.38  E-value: 4.12e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 201 MRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMyPPEIGDFAFVTDNtYTKH 280
Cdd:cd00043   1 MRPTPLDFLRRVAKALGLSPETLTLAVNLLDRFLLDYSVLGRSPSLVAAAALYLAAKVEEI-PPWLKDLVHVTGY-ATEE 78
                        90
                ....*....|
gi 14327896 281 QIRQMEMKIL 290
Cdd:cd00043  79 EILRMEKLLL 88
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
298-383 3.92e-19

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


:

Pssm-ID: 238003  Cd Length: 88  Bit Score: 81.90  E-value: 3.92e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 298 GRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSY-TEESL 376
Cdd:cd00043   1 MRPTPLDFLRRVAKALGLSPETLTLAVNLLDRFLLDYSVLGRSPSLVAAAALYLAAKVEEIPPWLKDLVHVTGYaTEEEI 80

                ....*..
gi 14327896 377 LPVMQHL 383
Cdd:cd00043  81 LRMEKLL 87
 
Name Accession Description Interval E-value
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
201-290 4.12e-24

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


Pssm-ID: 238003  Cd Length: 88  Bit Score: 95.38  E-value: 4.12e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 201 MRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMyPPEIGDFAFVTDNtYTKH 280
Cdd:cd00043   1 MRPTPLDFLRRVAKALGLSPETLTLAVNLLDRFLLDYSVLGRSPSLVAAAALYLAAKVEEI-PPWLKDLVHVTGY-ATEE 78
                        90
                ....*....|
gi 14327896 281 QIRQMEMKIL 290
Cdd:cd00043  79 EILRMEKLLL 88
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
298-383 3.92e-19

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


Pssm-ID: 238003  Cd Length: 88  Bit Score: 81.90  E-value: 3.92e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 298 GRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSY-TEESL 376
Cdd:cd00043   1 MRPTPLDFLRRVAKALGLSPETLTLAVNLLDRFLLDYSVLGRSPSLVAAAALYLAAKVEEIPPWLKDLVHVTGYaTEEEI 80

                ....*..
gi 14327896 377 LPVMQHL 383
Cdd:cd00043  81 LRMEKLL 87
Cyclin_N pfam00134
Cyclin, N-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human cyclin-O is ...
173-298 1.65e-59

Cyclin, N-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human cyclin-O is a Uracil-DNA glycosylase that is related to other cyclins. Cyclins contain two domains of similar all-alpha fold, of which this family corresponds with the N-terminal domain.


Pssm-ID: 249617  Cd Length: 127  Bit Score: 192.37  E-value: 1.65e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896   173 DIYAYLRQLEEEQAVRPKYL-LGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTA 251
Cdd:pfam00134   1 DIYAYLRELEEEFRPPPDYLdQQPDINPKMRAILIDWLVEVHEEFKLLPETLYLAVNYLDRFLSKQPVPRTKLQLVGVTC 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 14327896   252 MFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLG 298
Cdd:pfam00134  81 LLIAAKYEEIYPPSVEDFVYITDNAYTKEEILRMELLILSTLNWDLS 127
Cyclin_C pfam02984
Cyclin, C-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human CCNO is a ...
300-418 1.25e-45

Cyclin, C-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human CCNO is a Uracil-DNA glycosylase that is related to other cyclins. Cyclins contain two domains of similar all-alpha fold, of which this family corresponds with the C-terminal domain.


Pssm-ID: 251658  Cd Length: 118  Bit Score: 155.48  E-value: 1.25e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896   300 PLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE-WTPTLQHYLSYTEESLLP 378
Cdd:pfam02984   1 PTPLSFLRRFSKAADVDKETETLAKYLLELSLLDYDFLKYPPSLIAAAAVYLARKTLNPSPpWTETLEHYTGYSEEDLKP 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 14327896   379 VMQHLAKNVVMVNQglTKHMTVKNKYATSKHAKISTLPQL 418
Cdd:pfam02984  81 CVKLLLELLLKAPE--SKLQAVRKKYSSSKFGSVSTLPPP 118
CYCLIN smart00385
domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and ...
207-291 9.77e-21

domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.


Pssm-ID: 214641  Cd Length: 83  Bit Score: 86.11  E-value: 9.77e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896    207 DWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDntYTKHQIRQME 286
Cdd:smart00385   1 DFLRRVCKALNLDPETLNLAVNLLDRFLSDYKFLKYSPSLIAAAALYLASKTEETPPWTKELVHYTGY--FTEEEILRME 78

                   ....*
gi 14327896    287 MKILR 291
Cdd:smart00385  79 RLLLE 83
CYCLIN smart00385
domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and ...
304-385 8.30e-19

domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.


Pssm-ID: 214641  Cd Length: 83  Bit Score: 80.71  E-value: 8.30e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896    304 HFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSY-TEESLLPVMQH 382
Cdd:smart00385   1 DFLRRVCKALNLDPETLNLAVNLLDRFLSDYKFLKYSPSLIAAAALYLASKTEETPPWTKELVHYTGYfTEEEILRMERL 80

                   ...
gi 14327896    383 LAK 385
Cdd:smart00385  81 LLE 83
COG5024 COG5024
Cyclin [Cell division and chromosome partitioning]
154-413 6.48e-68

Cyclin [Cell division and chromosome partitioning]


Pssm-ID: 227357 [Multi-domain]  Cd Length: 440  Bit Score: 224.65  E-value: 6.48e-68
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 154 NDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLG-REVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDR 232
Cdd:COG5024 164 QDLDATDQEDPLMVPEYASDIFEYLLKLELIDLPNPNYLIKqSLYEWSMRSILVDWLVEVHGKFGLLPETLFLAINIIDR 243
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 233 FMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKI 312
Cdd:COG5024 244 FLSSRVVSLEKYQLVGISALFIASKYEEVNCPSIKDLVYATDGAFTRDDIIRAERYMLEVLDFNISWPSPMSFLRRISKA 323
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 313 GEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLS-YTEESLLPVMQHLAKNvvmVN 391
Cdd:COG5024 324 SDYDIFSRTPAKFSSEISPVDYKFIQISPSWCAAAAMYLSRKILSQNQWDRTLIHYSGnYTNPDLKPLNESNKEN---LQ 400
                       250       260
                ....*....|....*....|..
gi 14327896 392 QGLTKHMTVKNKYATSKHAKIS 413
Cdd:COG5024 401 NPSVHHDAIFPKYPSPTFGKAS 422
 
Name Accession Description Interval E-value
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
201-290 4.12e-24

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


Pssm-ID: 238003  Cd Length: 88  Bit Score: 95.38  E-value: 4.12e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 201 MRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMyPPEIGDFAFVTDNtYTKH 280
Cdd:cd00043   1 MRPTPLDFLRRVAKALGLSPETLTLAVNLLDRFLLDYSVLGRSPSLVAAAALYLAAKVEEI-PPWLKDLVHVTGY-ATEE 78
                        90
                ....*....|
gi 14327896 281 QIRQMEMKIL 290
Cdd:cd00043  79 EILRMEKLLL 88
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
298-383 3.92e-19

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


Pssm-ID: 238003  Cd Length: 88  Bit Score: 81.90  E-value: 3.92e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 298 GRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSY-TEESL 376
Cdd:cd00043   1 MRPTPLDFLRRVAKALGLSPETLTLAVNLLDRFLLDYSVLGRSPSLVAAAALYLAAKVEEIPPWLKDLVHVTGYaTEEEI 80

                ....*..
gi 14327896 377 LPVMQHL 383
Cdd:cd00043  81 LRMEKLL 87
Cyclin_N pfam00134
Cyclin, N-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human cyclin-O is ...
173-298 1.65e-59

Cyclin, N-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human cyclin-O is a Uracil-DNA glycosylase that is related to other cyclins. Cyclins contain two domains of similar all-alpha fold, of which this family corresponds with the N-terminal domain.


Pssm-ID: 249617  Cd Length: 127  Bit Score: 192.37  E-value: 1.65e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896   173 DIYAYLRQLEEEQAVRPKYL-LGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTA 251
Cdd:pfam00134   1 DIYAYLRELEEEFRPPPDYLdQQPDINPKMRAILIDWLVEVHEEFKLLPETLYLAVNYLDRFLSKQPVPRTKLQLVGVTC 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 14327896   252 MFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLG 298
Cdd:pfam00134  81 LLIAAKYEEIYPPSVEDFVYITDNAYTKEEILRMELLILSTLNWDLS 127
Cyclin_C pfam02984
Cyclin, C-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human CCNO is a ...
300-418 1.25e-45

Cyclin, C-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Human CCNO is a Uracil-DNA glycosylase that is related to other cyclins. Cyclins contain two domains of similar all-alpha fold, of which this family corresponds with the C-terminal domain.


Pssm-ID: 251658  Cd Length: 118  Bit Score: 155.48  E-value: 1.25e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896   300 PLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE-WTPTLQHYLSYTEESLLP 378
Cdd:pfam02984   1 PTPLSFLRRFSKAADVDKETETLAKYLLELSLLDYDFLKYPPSLIAAAAVYLARKTLNPSPpWTETLEHYTGYSEEDLKP 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 14327896   379 VMQHLAKNVVMVNQglTKHMTVKNKYATSKHAKISTLPQL 418
Cdd:pfam02984  81 CVKLLLELLLKAPE--SKLQAVRKKYSSSKFGSVSTLPPP 118
CYCLIN smart00385
domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and ...
207-291 9.77e-21

domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.


Pssm-ID: 214641  Cd Length: 83  Bit Score: 86.11  E-value: 9.77e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896    207 DWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDntYTKHQIRQME 286
Cdd:smart00385   1 DFLRRVCKALNLDPETLNLAVNLLDRFLSDYKFLKYSPSLIAAAALYLASKTEETPPWTKELVHYTGY--FTEEEILRME 78

                   ....*
gi 14327896    287 MKILR 291
Cdd:smart00385  79 RLLLE 83
CYCLIN smart00385
domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and ...
304-385 8.30e-19

domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.


Pssm-ID: 214641  Cd Length: 83  Bit Score: 80.71  E-value: 8.30e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896    304 HFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSY-TEESLLPVMQH 382
Cdd:smart00385   1 DFLRRVCKALNLDPETLNLAVNLLDRFLSDYKFLKYSPSLIAAAALYLASKTEETPPWTKELVHYTGYfTEEEILRMERL 80

                   ...
gi 14327896    383 LAK 385
Cdd:smart00385  81 LLE 83
COG5024 COG5024
Cyclin [Cell division and chromosome partitioning]
154-413 6.48e-68

Cyclin [Cell division and chromosome partitioning]


Pssm-ID: 227357 [Multi-domain]  Cd Length: 440  Bit Score: 224.65  E-value: 6.48e-68
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 154 NDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLG-REVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDR 232
Cdd:COG5024 164 QDLDATDQEDPLMVPEYASDIFEYLLKLELIDLPNPNYLIKqSLYEWSMRSILVDWLVEVHGKFGLLPETLFLAINIIDR 243
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 233 FMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKI 312
Cdd:COG5024 244 FLSSRVVSLEKYQLVGISALFIASKYEEVNCPSIKDLVYATDGAFTRDDIIRAERYMLEVLDFNISWPSPMSFLRRISKA 323
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 313 GEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLS-YTEESLLPVMQHLAKNvvmVN 391
Cdd:COG5024 324 SDYDIFSRTPAKFSSEISPVDYKFIQISPSWCAAAAMYLSRKILSQNQWDRTLIHYSGnYTNPDLKPLNESNKEN---LQ 400
                       250       260
                ....*....|....*....|..
gi 14327896 392 QGLTKHMTVKNKYATSKHAKIS 413
Cdd:COG5024 401 NPSVHHDAIFPKYPSPTFGKAS 422
CCL1 COG5333
Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision ...
208-361 1.57e-07

Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]


Pssm-ID: 227640 [Multi-domain]  Cd Length: 297  Bit Score: 51.27  E-value: 1.57e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 208 WLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMyPPEIGDFAFVTDNTYT------KHQ 281
Cdd:COG5333  51 LIMDLCTRLNLPQTVLATAILFFSRFYLKNSVEEISLYSVVTTCVYLACKVEDT-PRDISIESFEARDLWSeepkssRER 129
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14327896 282 IRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVD--VEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNG 359
Cdd:COG5333 130 ILEYEFELLEALDFDLHVHHPYKYLEGFLKDLQEKdkYKLLQIAWKIINDALRTDLCLLYPPHIIALAALLIACEVLGMP 209

                ..
gi 14327896 360 EW 361
Cdd:COG5333 210 II 211
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH