NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1420362|emb|CAA99347|]
View 

TY1A [Saccharomyces cerevisiae]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 2.53e-56

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


:

Pssm-ID: 279373  Cd Length: 98  Bit Score: 183.36  E-value: 2.53e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1420362     17 ACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVPTNQDPLDVSASKLPEFDKDSTKANSQQETTPGSSAVPENHHHASPQPAQVPPPQNGPYQQQGMMTPNQA 80
                          90
                  ....*....|....*...
gi 1420362     97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NASGWAHYGQPSMMPYSP 98
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 2.53e-56

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 279373  Cd Length: 98  Bit Score: 183.36  E-value: 2.53e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1420362     17 ACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVPTNQDPLDVSASKLPEFDKDSTKANSQQETTPGSSAVPENHHHASPQPAQVPPPQNGPYQQQGMMTPNQA 80
                          90
                  ....*....|....*...
gi 1420362     97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NASGWAHYGQPSMMPYSP 98
Cytadhesin_P30 pfam07271
Cytadhesin P30/P32; This family consists of several Mycoplasma species specific Cytadhesin P32 ...
45-144 4.30e-04

Cytadhesin P30/P32; This family consists of several Mycoplasma species specific Cytadhesin P32 and P30 proteins. P30 has been found to be membrane associated and localized on the tip organelle. It is thought that it is important in cytadherence and virulence.


Pssm-ID: 284643 [Multi-domain]  Cd Length: 308  Bit Score: 40.60  E-value: 4.30e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1420362     45 KASTKANSQQTTTPASSAVPENPHHASPQPASvpPPQNGPYPQQCMMTQNQANPSGWSFYG----------HPSMIPYTP 114
Cdd:pfam07271 137 QAAAEAHAEAETEPAGQNVANNPQMGINQPQI--NINFGPNPQQRINPQCFGFPMQPGQMAmrpgfnqmppHMGGAPPNQ 214
                          90       100       110
                  ....*....|....*....|....*....|
gi 1420362    115 YQMSPMYFPPGPqsQFPQYPSSVGTPLSTP 144
Cdd:pfam07271 215 MGMRPGFNQMPP--QMGGMAPRPGFPNHMP 242
PHA03247 PHA03247
large tegument protein UL36; Provisional
47-175 4.60e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 41.46  E-value: 4.60e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1420362     47 STKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANP-SGWSFYGHPSMIPYTPY--QMSPMYFP 123
Cdd:PHA03247 2894 STESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPtTDPAGAGEPSGAVPQPWlgALVPGRVA 2973
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1420362    124 PgPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPML 175
Cdd:PHA03247 2974 V-PRFRVPQPAPSREAPASSTPPLTGHSLSRVSSWASSLALHEETDPPPVSL 3024
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 2.53e-56

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 279373  Cd Length: 98  Bit Score: 183.36  E-value: 2.53e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1420362     17 ACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVPTNQDPLDVSASKLPEFDKDSTKANSQQETTPGSSAVPENHHHASPQPAQVPPPQNGPYQQQGMMTPNQA 80
                          90
                  ....*....|....*...
gi 1420362     97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NASGWAHYGQPSMMPYSP 98
Cytadhesin_P30 pfam07271
Cytadhesin P30/P32; This family consists of several Mycoplasma species specific Cytadhesin P32 ...
45-144 4.30e-04

Cytadhesin P30/P32; This family consists of several Mycoplasma species specific Cytadhesin P32 and P30 proteins. P30 has been found to be membrane associated and localized on the tip organelle. It is thought that it is important in cytadherence and virulence.


Pssm-ID: 284643 [Multi-domain]  Cd Length: 308  Bit Score: 40.60  E-value: 4.30e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1420362     45 KASTKANSQQTTTPASSAVPENPHHASPQPASvpPPQNGPYPQQCMMTQNQANPSGWSFYG----------HPSMIPYTP 114
Cdd:pfam07271 137 QAAAEAHAEAETEPAGQNVANNPQMGINQPQI--NINFGPNPQQRINPQCFGFPMQPGQMAmrpgfnqmppHMGGAPPNQ 214
                          90       100       110
                  ....*....|....*....|....*....|
gi 1420362    115 YQMSPMYFPPGPqsQFPQYPSSVGTPLSTP 144
Cdd:pfam07271 215 MGMRPGFNQMPP--QMGGMAPRPGFPNHMP 242
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
29-178 4.39e-04

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 281189 [Multi-domain]  Cd Length: 982  Bit Score: 41.16  E-value: 4.39e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1420362     29 NQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYG--- 105
Cdd:pfam03154 155 NESDSDSSAQQQILQTQPPVLQCQNGTPSPPPAPPTAAPTPAPTPATTLPPQPSPPTTSQPPQPIPQASPHTLIQQTptl 234
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1420362    106 HPSMIPYTPYQMSPMYFPPGPQSQFPQ---YPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKkyVRPPPMLTSP 178
Cdd:pfam03154 235 HPQRLPSPHPPLQPMPQPDPPSQAPPQsapQPGLHGPPPPTPHSLQGPPHLPHPLPPQPFGQGQ--VPPPPSFQAP 308
PHA03247 PHA03247
large tegument protein UL36; Provisional
47-175 4.60e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 41.46  E-value: 4.60e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1420362     47 STKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANP-SGWSFYGHPSMIPYTPY--QMSPMYFP 123
Cdd:PHA03247 2894 STESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPtTDPAGAGEPSGAVPQPWlgALVPGRVA 2973
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1420362    124 PgPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPML 175
Cdd:PHA03247 2974 V-PRFRVPQPAPSREAPASSTPPLTGHSLSRVSSWASSLALHEETDPPPVSL 3024
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
30-178 1.05e-03

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 281189 [Multi-domain]  Cd Length: 982  Bit Score: 40.00  E-value: 1.05e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1420362     30 QDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSM 109
Cdd:pfam03154 206 QPSPPTTSQPPQPIPQASPHTLIQQTPTLHPQRLPSPHPPLQPMPQPDPPSQAPPQSAPQPGLHGPPPPTPHSLQGPPHL 285
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1420362    110 I-PYTPYQMSPMYFPPGPQSQFPQYPSSVGT-PLSTPSPESGNTFTDSSSADSDMTSTkkYVRPPPMLTSP 178
Cdd:pfam03154 286 PhPLPPQPFGQGQVPPPPSFQAPHPSSQLQCqPPSQSSGPSPQPPREQPLPPAPLSMP--HIKPPPTTPIP 354
PHA03247 PHA03247
large tegument protein UL36; Provisional
56-149 1.31e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 39.92  E-value: 1.31e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1420362     56 TTPASSAVPENPHHASP--QPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMI----PYTPYQMSPMYFPPGPQSQ 129
Cdd:PHA03247 2755 ARPARPPTTAGPPAPAPpaAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPPAAVlapaAALPPAASPAGPLPPPTSA 2834
                          90       100
                  ....*....|....*....|
gi 1420362    130 FPQYPSSVGTPLSTPSPESG 149
Cdd:PHA03247 2835 QPTAPPPPPGPPPPSLPLGG 2854
Med15 pfam09606
ARC105 or Med15 subunit of Mediator complex non-fungal; The approx. 70 residue Med15 domain of ...
29-171 7.97e-03

ARC105 or Med15 subunit of Mediator complex non-fungal; The approx. 70 residue Med15 domain of the ARC-Mediator co-activator is a three-helix bundle with marked similarity to the KIX domain. The sterol regulatory element binding protein (SREBP) family of transcription activators use the ARC105 subunit to activate target genes in the regulation of cholesterol and fatty acid homeostasis. In addition, Med15 is a critical transducer of gene activation signals that control early metazoan development.


Pssm-ID: 255446 [Multi-domain]  Cd Length: 768  Bit Score: 37.29  E-value: 7.97e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1420362     29 NQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPypqqcmmtqNQANPSGwsfyghPS 108
Cdd:pfam09606 394 NQGGLGANPMQQGQPGMMSSPSPVPQVQTNQSMPQPPQPSVPSPGGPGSQPPQSVS---------GGMIPSP------PA 458
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1420362    109 MIPYTPYQMSPMyfpPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTK---KYVRP 171
Cdd:pfam09606 459 LMPSPSPQMSQS---PASQRTIQQDMVSPGGPLNTPGQSSVNSPANPQEEQLYREKYKqlsKYIEP 521
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH