NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|13929056|ref|NP_113940.1|]
View 

basal cell adhesion molecule precursor

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ig cd00096
Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
376-424 2.75e-06

Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


:

Pssm-ID: 143165 [Multi-domain]  Cd Length: 74  Bit Score: 45.56  E-value: 2.75e-06
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056 376 VVNCSARGLPAPIVRWTKDSVTVADGPI---------------LSLDSVTFDSAGTYTCEASTP 424
Cdd:cd00096   2 TLTCLASGPPPPTITWLKNGKPLPSSVLtrvrssrgtssgsstLTISNVTLEDSGTYTCVASNS 65
Ig cd00096
Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
464-532 1.86e-05

Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


:

Pssm-ID: 143165 [Multi-domain]  Cd Length: 74  Bit Score: 43.25  E-value: 1.86e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056 464 VMLTCSARGFPEPKLTWSQRGDTTPAE---PPFEGRGWMSSSLTLKVTSA-LSREGV-SCEASNIHGKNGHVFH 532
Cdd:cd00096   1 VTLTCLASGPPPPTITWLKNGKPLPSSvltRVRSSRGTSSGSSTLTISNVtLEDSGTyTCVASNSAGTVSASVT 74
C2-set_2 pfam08205
CD80-like C2-set immunoglobulin domain; These domains belong to the immunoglobulin superfamily.
145-242 1.05e-21

CD80-like C2-set immunoglobulin domain; These domains belong to the immunoglobulin superfamily.


:

Pssm-ID: 254659  Cd Length: 89  Bit Score: 90.57  E-value: 1.05e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056   145 EVAPNKGTLSVMEQfaQEIATCSSNNGNPVPRITWYQNGQRLdvpmelnsKGYMTSRTVREASGLYSLTSTLYLRLHKED 224
Cdd:pfam08205   2 TIEPPVSLLEGENL--EVVATCSSAGGKPAPRITWYLDGREL--------EAITTSSEQDPESGLYTVTSTLKLVPSRED 71
                          90
                  ....*....|....*...
gi 13929056   225 RDASFHCAAHYDLPSGQH 242
Cdd:pfam08205  72 HGRSLTCQVSYGALRGQK 89
Ig super family cl11960
Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
27-137 5.18e-04

Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


The actual alignment was detected with superfamily member cd04977:

Pssm-ID: 276006  Cd Length: 92  Bit Score: 38.66  E-value: 5.18e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056  27 LHVS-VPPRVEVMRGEQIALDCTPREHPENyvLEWllvdasgarhrlasVEPQGSEFLgtihnSRGRRPPYKIDS-LGRL 104
Cdd:cd04977   1 LQVDiVPSQGEISVGESKFFLCQVIGEPKD--ISW--------------FSPNGEKLV-----TQQQISVVQNDDvRSTL 59
                        90       100       110
                ....*....|....*....|....*....|...
gi 13929056 105 VIAEAQVGDERDYVCVVKAGAAGTSEATSSVRV 137
Cdd:cd04977  60 TIYNANIEDAGIYKCVATDAKGTESEATVNLKI 92
Ig_2 pfam13895
Immunoglobulin domain; This domain contains immunoglobulin-like domains.
275-333 1.44e-03

Immunoglobulin domain; This domain contains immunoglobulin-like domains.


:

Pssm-ID: 258162  Cd Length: 80  Bit Score: 37.39  E-value: 1.44e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 13929056   275 VREGDAVQLLCQGDGSPSPEYSFFREqgnqEEQLNVNLKGNLTLEgVHRSQSGIYGCRV 333
Cdd:pfam13895  11 VFEGEDVTLTCSAPGNPPPNYTWYKD----GTALSSSQNGSFTPN-VSESDSGTYTCTA 64
IGc2 smart00408
Immunoglobulin C-2 Type;
277-335 4.11e-07

Immunoglobulin C-2 Type;


:

Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 47.79  E-value: 4.11e-07
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056    277 EGDAVQLLCQGDGSPSPEYSFFREQGNQEEQLNVNLKGN-LTLEGVHRSQSGIYGCRVED 335
Cdd:smart00408   1 EGQSVTLTCPAEGNPVPNITWLKDGKPLPESNRFVASGStLTIKSVSLEDSGLYTCVAEN 60
IGc2 smart00408
Immunoglobulin C-2 Type;
460-525 3.82e-05

Immunoglobulin C-2 Type;


:

Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 42.01  E-value: 3.82e-05
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 13929056    460 EGDEVMLTCSARGFPEPKLTWSQRGDTTPaeppfEGRGWMSSSLTLKVTSA-LSREGV-SCEASNIHG 525
Cdd:smart00408   1 EGQSVTLTCPAEGNPVPNITWLKDGKPLP-----ESNRFVASGSTLTIKSVsLEDSGLyTCVAENSAG 63
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
32-137 1.12e-03

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


:

Pssm-ID: 214653 [Multi-domain]  Cd Length: 85  Bit Score: 37.87  E-value: 1.12e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056     32 PPRVEVMRGEQIALDCTPREHPENYVlEWLLvdasgarhrlasvepQGSEFLGTIHNSRGRRPPykidSLGRLVIAEAQV 111
Cdd:smart00410   1 PPSVTVKEGESVTLSCEASGSPPPEV-TWYK---------------QGGKLLAESGRFSVSRSG----STSTLTISNVTP 60
                           90       100
                   ....*....|....*....|....*.
gi 13929056    112 GDERDYVCVVKAGaAGTSEATSSVRV 137
Cdd:smart00410  61 EDSGTYTCAATNS-SGSASSGTTLTV 85
IGc2 smart00408
Immunoglobulin C-2 Type;
376-424 1.16e-08

Immunoglobulin C-2 Type;


:

Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 52.41  E-value: 1.16e-08
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 13929056    376 VVNCSARGLPAPIVRWTKDS-------VTVADGPILSLDSVTFDSAGTYTCEASTP 424
Cdd:smart00408   6 TLTCPAEGNPVPNITWLKDGkplpesnRFVASGSTLTIKSVSLEDSGLYTCVAENS 61
 
Name Accession Description Interval E-value
Ig cd00096
Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
376-424 2.75e-06

Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 143165 [Multi-domain]  Cd Length: 74  Bit Score: 45.56  E-value: 2.75e-06
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056 376 VVNCSARGLPAPIVRWTKDSVTVADGPI---------------LSLDSVTFDSAGTYTCEASTP 424
Cdd:cd00096   2 TLTCLASGPPPPTITWLKNGKPLPSSVLtrvrssrgtssgsstLTISNVTLEDSGTYTCVASNS 65
Ig cd00096
Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
464-532 1.86e-05

Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 143165 [Multi-domain]  Cd Length: 74  Bit Score: 43.25  E-value: 1.86e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056 464 VMLTCSARGFPEPKLTWSQRGDTTPAE---PPFEGRGWMSSSLTLKVTSA-LSREGV-SCEASNIHGKNGHVFH 532
Cdd:cd00096   1 VTLTCLASGPPPPTITWLKNGKPLPSSvltRVRSSRGTSSGSSTLTISNVtLEDSGTyTCVASNSAGTVSASVT 74
C2-set_2 pfam08205
CD80-like C2-set immunoglobulin domain; These domains belong to the immunoglobulin superfamily.
145-242 1.05e-21

CD80-like C2-set immunoglobulin domain; These domains belong to the immunoglobulin superfamily.


Pssm-ID: 254659  Cd Length: 89  Bit Score: 90.57  E-value: 1.05e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056   145 EVAPNKGTLSVMEQfaQEIATCSSNNGNPVPRITWYQNGQRLdvpmelnsKGYMTSRTVREASGLYSLTSTLYLRLHKED 224
Cdd:pfam08205   2 TIEPPVSLLEGENL--EVVATCSSAGGKPAPRITWYLDGREL--------EAITTSSEQDPESGLYTVTSTLKLVPSRED 71
                          90
                  ....*....|....*...
gi 13929056   225 RDASFHCAAHYDLPSGQH 242
Cdd:pfam08205  72 HGRSLTCQVSYGALRGQK 89
Ig_2 pfam13895
Immunoglobulin domain; This domain contains immunoglobulin-like domains.
367-439 1.27e-06

Immunoglobulin domain; This domain contains immunoglobulin-like domains.


Pssm-ID: 258162  Cd Length: 80  Bit Score: 46.64  E-value: 1.27e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056   367 SVFLNSSGTVvNCSARGLPAPIVRWTKDSVTVADGP-ILSLDSVTFDSAGTYTCEASTPTVPLLSRTqsFQLVV 439
Cdd:pfam13895  10 VVFEGEDVTL-TCSAPGNPPPNYTWYKDGTALSSSQnGSFTPNVSESDSGTYTCTARNGGGSKTSNP--VELTV 80
C2-set_2 pfam08205
CD80-like C2-set immunoglobulin domain; These domains belong to the immunoglobulin superfamily.
448-522 1.38e-04

CD80-like C2-set immunoglobulin domain; These domains belong to the immunoglobulin superfamily.


Pssm-ID: 254659  Cd Length: 89  Bit Score: 40.49  E-value: 1.38e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056   448 NEIKPKSGTSWTEGDEVMLTCSAR-GFPEPKLTW-----SQRGDTTPAEPPFEGRGWM-SSSLTLKVTSALSREGVSCEA 520
Cdd:pfam08205   1 PTIEPPVSLLEGENLEVVATCSSAgGKPAPRITWyldgrELEAITTSSEQDPESGLYTvTSTLKLVPSREDHGRSLTCQV 80

                  ..
gi 13929056   521 SN 522
Cdd:pfam08205  81 SY 82
IgC cd00098
Immunoglobulin Constant domain; IgC: Immunoglobulin constant domain (IgC). Members of the IgC ...
135-239 2.91e-04

Immunoglobulin Constant domain; IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.


Pssm-ID: 143166  Cd Length: 95  Bit Score: 39.74  E-value: 2.91e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056 135 VRVFAtPEATEVAPNKGTLsvmeqfaqeiaTCSSNNGNPVP-RITWYQNGQRLdvpmelnSKGYMTSRTVREASGLYSLT 213
Cdd:cd00098   1 VFLLP-PSPEELLGGSVTL-----------TCLATGFYPPDiTVTWLKNGKEL-------TSGVTTTPPVPNSDGTYSVS 61
                        90       100
                ....*....|....*....|....*..
gi 13929056 214 STLYLRLHKEDRDASFHC-AAHYDLPS 239
Cdd:cd00098  62 SQLTVSPSDWNSGDTYTCvVTHESLPE 88
Ig1_NCAM-1_like cd04977
First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar ...
27-137 5.18e-04

First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins; Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans interactions), through binding to the Ig1 and Ig2 domains. The adhesive ability of NCAM is modulated by the addition of polysialic acid chains to the fifth Ig-like domain. Also included in this group is NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE).


Pssm-ID: 143178  Cd Length: 92  Bit Score: 38.66  E-value: 5.18e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056  27 LHVS-VPPRVEVMRGEQIALDCTPREHPENyvLEWllvdasgarhrlasVEPQGSEFLgtihnSRGRRPPYKIDS-LGRL 104
Cdd:cd04977   1 LQVDiVPSQGEISVGESKFFLCQVIGEPKD--ISW--------------FSPNGEKLV-----TQQQISVVQNDDvRSTL 59
                        90       100       110
                ....*....|....*....|....*....|...
gi 13929056 105 VIAEAQVGDERDYVCVVKAGAAGTSEATSSVRV 137
Cdd:cd04977  60 TIYNANIEDAGIYKCVATDAKGTESEATVNLKI 92
Ig_2 pfam13895
Immunoglobulin domain; This domain contains immunoglobulin-like domains.
275-333 1.44e-03

Immunoglobulin domain; This domain contains immunoglobulin-like domains.


Pssm-ID: 258162  Cd Length: 80  Bit Score: 37.39  E-value: 1.44e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 13929056   275 VREGDAVQLLCQGDGSPSPEYSFFREqgnqEEQLNVNLKGNLTLEgVHRSQSGIYGCRV 333
Cdd:pfam13895  11 VFEGEDVTLTCSAPGNPPPNYTWYKD----GTALSSSQNGSFTPN-VSESDSGTYTCTA 64
Ig4_Contactin-2-like cd05728
Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins; ...
264-335 1.71e-03

Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins; Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.


Pssm-ID: 143205  Cd Length: 85  Bit Score: 37.19  E-value: 1.71e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056 264 WVGSPSTTEGWVreGDAVQLLCQGDGSPSPEYSFFR--EQGNQEEQLNVnLKGNLTLEGVHRSQSGIYGCRVED 335
Cdd:cd05728   2 WLKVISDTEADI--GSSLRWECKASGNPRPAYRWLKngQPLASENRIEV-EAGDLRITKLSLSDSGMYQCVAEN 72
IGc2 smart00408
Immunoglobulin C-2 Type;
277-335 4.11e-07

Immunoglobulin C-2 Type;


Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 47.79  E-value: 4.11e-07
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056    277 EGDAVQLLCQGDGSPSPEYSFFREQGNQEEQLNVNLKGN-LTLEGVHRSQSGIYGCRVED 335
Cdd:smart00408   1 EGQSVTLTCPAEGNPVPNITWLKDGKPLPESNRFVASGStLTIKSVSLEDSGLYTCVAEN 60
IGc2 smart00408
Immunoglobulin C-2 Type;
460-525 3.82e-05

Immunoglobulin C-2 Type;


Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 42.01  E-value: 3.82e-05
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 13929056    460 EGDEVMLTCSARGFPEPKLTWSQRGDTTPaeppfEGRGWMSSSLTLKVTSA-LSREGV-SCEASNIHG 525
Cdd:smart00408   1 EGQSVTLTCPAEGNPVPNITWLKDGKPLP-----ESNRFVASGSTLTIKSVsLEDSGLyTCVAENSAG 63
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
32-137 1.12e-03

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653 [Multi-domain]  Cd Length: 85  Bit Score: 37.87  E-value: 1.12e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056     32 PPRVEVMRGEQIALDCTPREHPENYVlEWLLvdasgarhrlasvepQGSEFLGTIHNSRGRRPPykidSLGRLVIAEAQV 111
Cdd:smart00410   1 PPSVTVKEGESVTLSCEASGSPPPEV-TWYK---------------QGGKLLAESGRFSVSRSG----STSTLTISNVTP 60
                           90       100
                   ....*....|....*....|....*.
gi 13929056    112 GDERDYVCVVKAGaAGTSEATSSVRV 137
Cdd:smart00410  61 EDSGTYTCAATNS-SGSASSGTTLTV 85
IGc2 smart00408
Immunoglobulin C-2 Type;
376-424 1.16e-08

Immunoglobulin C-2 Type;


Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 52.41  E-value: 1.16e-08
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 13929056    376 VVNCSARGLPAPIVRWTKDS-------VTVADGPILSLDSVTFDSAGTYTCEASTP 424
Cdd:smart00408   6 TLTCPAEGNPVPNITWLKDGkplpesnRFVASGSTLTIKSVSLEDSGLYTCVAENS 61
I-set pfam07679
Immunoglobulin I-set domain;
449-526 1.57e-04

Immunoglobulin I-set domain;


Pssm-ID: 254352 [Multi-domain]  Cd Length: 90  Bit Score: 40.32  E-value: 1.57e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056   449 EIKPKSGTSwTEGDEVMLTCSARGFPEPKLTWSQRGDTTPAEPPFEGRgWMSSSLTLKVTSA-LSREGV-SCEASNIHGK 526
Cdd:pfam07679   4 TQKPKDVEV-QEGESARFTCTVTGTPDPEVSWFKDGQPLRSSDRFKVT-YEGGTYTLTISNVqPDDSGKyTCVATNSAGE 81
I-set pfam07679
Immunoglobulin I-set domain;
360-422 3.61e-04

Immunoglobulin I-set domain;


Pssm-ID: 254352 [Multi-domain]  Cd Length: 90  Bit Score: 39.16  E-value: 3.61e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056   360 LSVPEEFSVFLNssgtvvnCSARGLPAPIVRWTKDSVTVADGPI-----------LSLDSVTFDSAGTYTCEAS 422
Cdd:pfam07679  10 VEVQEGESARFT-------CTVTGTPDPEVSWFKDGQPLRSSDRfkvtyeggtytLTISNVQPDDSGKYTCVAT 76
I-set pfam07679
Immunoglobulin I-set domain;
275-334 9.89e-04

Immunoglobulin I-set domain;


Pssm-ID: 254352 [Multi-domain]  Cd Length: 90  Bit Score: 38.01  E-value: 9.89e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 13929056   275 VREGDAVQLLCQGDGSPSPEYSFFR--EQGNQEEQLNVNLKGN---LTLEGVHRSQSGIYGCRVE 334
Cdd:pfam07679  12 VQEGESARFTCTVTGTPDPEVSWFKdgQPLRSSDRFKVTYEGGtytLTISNVQPDDSGKYTCVAT 76
I-set pfam07679
Immunoglobulin I-set domain;
29-137 2.13e-03

Immunoglobulin I-set domain;


Pssm-ID: 254352 [Multi-domain]  Cd Length: 90  Bit Score: 36.85  E-value: 2.13e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056    29 VSVPPRVEVMRGEQIALDCTPREHPENYVlEWLLVD---ASGARHRlasvepqgseflgtIHNSRGRrppykidslGRLV 105
Cdd:pfam07679   4 TQKPKDVEVQEGESARFTCTVTGTPDPEV-SWFKDGqplRSSDRFK--------------VTYEGGT---------YTLT 59
                          90       100       110
                  ....*....|....*....|....*....|..
gi 13929056   106 IAEAQVGDERDYVCVVKaGAAGTSEATSSVRV 137
Cdd:pfam07679  60 ISNVQPDDSGKYTCVAT-NSAGEAEASAELTV 90
IGc2 smart00408
Immunoglobulin C-2 Type;
165-211 7.71e-03

Immunoglobulin C-2 Type;


Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 35.08  E-value: 7.71e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 13929056    165 TCSSNnGNPVPRITWYQNGQRLDVPMELN-SKGYMTSRTVREA-SGLYS 211
Cdd:smart00408   8 TCPAE-GNPVPNITWLKDGKPLPESNRFVaSGSTLTIKSVSLEdSGLYT 55
 
Name Accession Description Interval E-value
Ig cd00096
Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
376-424 2.75e-06

Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 143165 [Multi-domain]  Cd Length: 74  Bit Score: 45.56  E-value: 2.75e-06
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056 376 VVNCSARGLPAPIVRWTKDSVTVADGPI---------------LSLDSVTFDSAGTYTCEASTP 424
Cdd:cd00096   2 TLTCLASGPPPPTITWLKNGKPLPSSVLtrvrssrgtssgsstLTISNVTLEDSGTYTCVASNS 65
Ig cd00096
Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
464-532 1.86e-05

Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 143165 [Multi-domain]  Cd Length: 74  Bit Score: 43.25  E-value: 1.86e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056 464 VMLTCSARGFPEPKLTWSQRGDTTPAE---PPFEGRGWMSSSLTLKVTSA-LSREGV-SCEASNIHGKNGHVFH 532
Cdd:cd00096   1 VTLTCLASGPPPPTITWLKNGKPLPSSvltRVRSSRGTSSGSSTLTISNVtLEDSGTyTCVASNSAGTVSASVT 74
C2-set_2 pfam08205
CD80-like C2-set immunoglobulin domain; These domains belong to the immunoglobulin superfamily.
145-242 1.05e-21

CD80-like C2-set immunoglobulin domain; These domains belong to the immunoglobulin superfamily.


Pssm-ID: 254659  Cd Length: 89  Bit Score: 90.57  E-value: 1.05e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056   145 EVAPNKGTLSVMEQfaQEIATCSSNNGNPVPRITWYQNGQRLdvpmelnsKGYMTSRTVREASGLYSLTSTLYLRLHKED 224
Cdd:pfam08205   2 TIEPPVSLLEGENL--EVVATCSSAGGKPAPRITWYLDGREL--------EAITTSSEQDPESGLYTVTSTLKLVPSRED 71
                          90
                  ....*....|....*...
gi 13929056   225 RDASFHCAAHYDLPSGQH 242
Cdd:pfam08205  72 HGRSLTCQVSYGALRGQK 89
Ig_2 pfam13895
Immunoglobulin domain; This domain contains immunoglobulin-like domains.
367-439 1.27e-06

Immunoglobulin domain; This domain contains immunoglobulin-like domains.


Pssm-ID: 258162  Cd Length: 80  Bit Score: 46.64  E-value: 1.27e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056   367 SVFLNSSGTVvNCSARGLPAPIVRWTKDSVTVADGP-ILSLDSVTFDSAGTYTCEASTPTVPLLSRTqsFQLVV 439
Cdd:pfam13895  10 VVFEGEDVTL-TCSAPGNPPPNYTWYKDGTALSSSQnGSFTPNVSESDSGTYTCTARNGGGSKTSNP--VELTV 80
Ig5_NCAM-1_like cd05732
Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and ...
446-522 6.21e-05

Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins; Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans interactions), through binding to the Ig1 and Ig2 domains. The adhesive ability of NCAM is modulated by the addition of polysialic acid chains to the fifth Ig-like domain. Also included in this group is NCAM-2 (also known as OCAM/mamFas II and RNCAM) NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE).


Pssm-ID: 143209  Cd Length: 96  Bit Score: 41.74  E-value: 6.21e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056 446 KPNEIKPKSGTSwTEGDEVMLTCSARGFPEPKLTWSQ------RGDTTPaEPPFEGRG-WMSSSLTLKVTSALSREGVSC 518
Cdd:cd05732   2 QPKITYLENQTA-VELEQITLTCEAEGDPIPEITWRRatrnfsEGDKSL-DGRIVVRGhARVSSLTLKDVQLTDAGRYDC 79

                ....
gi 13929056 519 EASN 522
Cdd:cd05732  80 EASN 83
Ig_3 pfam13927
Immunoglobulin domain; This family contains immunoglobulin-like domains.
377-423 6.90e-05

Immunoglobulin domain; This family contains immunoglobulin-like domains.


Pssm-ID: 258189  Cd Length: 75  Bit Score: 41.58  E-value: 6.90e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 13929056   377 VNCSARGLPAPI-VRWTKDSVTV-------ADGPILSLDSVTFDSAGTYTCEAST 423
Cdd:pfam13927  21 LTCSAEGGPPPPtISWYRNGSISngsgglgSSGSTLTISSVTPEDSGTYTCVASN 75
Ig3_Contactin-1 cd05851
Third Ig domain of contactin-1; Ig3_Contactin-1: Third Ig domain of the neural cell adhesion ...
461-529 9.92e-05

Third Ig domain of contactin-1; Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.


Pssm-ID: 143259  Cd Length: 88  Bit Score: 41.16  E-value: 9.92e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056 461 GDEVMLTCSARGFPEPKLTWSQRGDTTPAEPPFEgrgwMSSSLTLKVTSALSREGV-SCEASNIHGKNGH 529
Cdd:cd05851  16 GQNVTLECFALGNPVPVIRWRKILEPMPATAEIS----MSGAVLKIFNIQPEDEGTyECEAENIKGKDKH 81
C2-set_2 pfam08205
CD80-like C2-set immunoglobulin domain; These domains belong to the immunoglobulin superfamily.
448-522 1.38e-04

CD80-like C2-set immunoglobulin domain; These domains belong to the immunoglobulin superfamily.


Pssm-ID: 254659  Cd Length: 89  Bit Score: 40.49  E-value: 1.38e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056   448 NEIKPKSGTSWTEGDEVMLTCSAR-GFPEPKLTW-----SQRGDTTPAEPPFEGRGWM-SSSLTLKVTSALSREGVSCEA 520
Cdd:pfam08205   1 PTIEPPVSLLEGENLEVVATCSSAgGKPAPRITWyldgrELEAITTSSEQDPESGLYTvTSTLKLVPSREDHGRSLTCQV 80

                  ..
gi 13929056   521 SN 522
Cdd:pfam08205  81 SY 82
Ig3_Robo cd05725
Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors; Ig3_Robo: domain similar ...
376-421 1.44e-04

Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors; Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagonizes slit responsiveness in precrossing axons. The Slit-Robo interaction is mediated by the second leucine-rich repeat (LRR) domain of Slit and the two N-terminal Ig domains of Robo, Ig1 and Ig2. The primary Robo binding site for Slit2 has been shown by surface plasmon resonance experiments and mutational analysis to be is the Ig1 domain, while the Ig2 domain has been proposed to harbor a weak secondary binding site.


Pssm-ID: 143202 [Multi-domain]  Cd Length: 69  Bit Score: 40.47  E-value: 1.44e-04
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|...
gi 13929056 376 VVNCSARGLPAPIVRWTKDS-------VTVADGPILSLDSVTFDSAGTYTCEA 421
Cdd:cd05725   2 EFQCEVGGDPVPTVLWRKEDgelpkgrAEILDDKSLKIRNVTAGDEGSYTCEA 54
Ig4_L1-NrCAM_like cd04978
Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), ...
461-525 2.83e-04

Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related); Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.


Pssm-ID: 143179 [Multi-domain]  Cd Length: 76  Bit Score: 39.69  E-value: 2.83e-04
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 13929056 461 GDEVMLTCSARGFPEPKLTWSQRGDTTPAEPPFEGRGWMSSSLTLKVTSALSREGVSCEASNIHG 525
Cdd:cd04978   1 GETGRLDCEAEGIPQPTITWRLNGVPIEELPPDPRRRVDGGTLILSNVQPNDTAVYQCNASNVHG 65
IgC cd00098
Immunoglobulin Constant domain; IgC: Immunoglobulin constant domain (IgC). Members of the IgC ...
135-239 2.91e-04

Immunoglobulin Constant domain; IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.


Pssm-ID: 143166  Cd Length: 95  Bit Score: 39.74  E-value: 2.91e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056 135 VRVFAtPEATEVAPNKGTLsvmeqfaqeiaTCSSNNGNPVP-RITWYQNGQRLdvpmelnSKGYMTSRTVREASGLYSLT 213
Cdd:cd00098   1 VFLLP-PSPEELLGGSVTL-----------TCLATGFYPPDiTVTWLKNGKEL-------TSGVTTTPPVPNSDGTYSVS 61
                        90       100
                ....*....|....*....|....*..
gi 13929056 214 STLYLRLHKEDRDASFHC-AAHYDLPS 239
Cdd:cd00098  62 SQLTVSPSDWNSGDTYTCvVTHESLPE 88
Ig1_NCAM-1_like cd04977
First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar ...
27-137 5.18e-04

First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins; Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans interactions), through binding to the Ig1 and Ig2 domains. The adhesive ability of NCAM is modulated by the addition of polysialic acid chains to the fifth Ig-like domain. Also included in this group is NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE).


Pssm-ID: 143178  Cd Length: 92  Bit Score: 38.66  E-value: 5.18e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056  27 LHVS-VPPRVEVMRGEQIALDCTPREHPENyvLEWllvdasgarhrlasVEPQGSEFLgtihnSRGRRPPYKIDS-LGRL 104
Cdd:cd04977   1 LQVDiVPSQGEISVGESKFFLCQVIGEPKD--ISW--------------FSPNGEKLV-----TQQQISVVQNDDvRSTL 59
                        90       100       110
                ....*....|....*....|....*....|...
gi 13929056 105 VIAEAQVGDERDYVCVVKAGAAGTSEATSSVRV 137
Cdd:cd04977  60 TIYNANIEDAGIYKCVATDAKGTESEATVNLKI 92
Ig3_NCAM-1_like cd05730
Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM); ...
461-532 5.18e-04

Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM); Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans interactions), through binding to the Ig1 and Ig2 domains. The adhesive ability of NCAM is modulated by the addition of polysialic acid chains to the fifth Ig-like domain.


Pssm-ID: 143207  Cd Length: 95  Bit Score: 38.76  E-value: 5.18e-04
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 13929056 461 GDEVMLTCSARGFPEPKLTWSQRGDTTPAEPPFEGRGWMSSSLTLKVTSALSREGVSCEASNIHGKNGHVFH 532
Cdd:cd05730  18 GQSVTLACDADGFPEPTMTWTKDGEPIESGEEKYSFNEDGSEMTILDVDKLDEAEYTCIAENKAGEQEAEIH 89
Ig2_PVR_like cd05719
Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and ...
163-218 6.98e-04

Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins; Ig2_PVR_like: domain similar to the second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), these result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "canyon", it has a footprint similar to that of the intercellular adhesion molecule-1 receptor on human rhinoviruses. This group also includes the second Ig-like domain of nectin-1 (also known as poliovirus receptor related protein(PVRL)1; CD111).


Pssm-ID: 143196  Cd Length: 95  Bit Score: 38.47  E-value: 6.98e-04
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 13929056 163 IATCSSNNGNPVPRITWyqngqrldvpmELNSKGYMTSRTVREASGLYSLTSTLYL 218
Cdd:cd05719  19 VATCVSANGKPPATISW-----------ETTLGGEAETQSKENPNGTVTVTSEYRL 63
Ig4_Peroxidasin cd05746
Fourth immunoglobulin (Ig)-like domain of peroxidasin; Ig4_Peroxidasin: the fourth ...
379-424 8.32e-04

Fourth immunoglobulin (Ig)-like domain of peroxidasin; Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.


Pssm-ID: 143223  Cd Length: 69  Bit Score: 37.93  E-value: 8.32e-04
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....
gi 13929056 379 CSARGLPAPIVRWTKDSVTVADGP--------ILSLDSVTFDSAGTYTCEASTP 424
Cdd:cd05746   5 CSAQGDPEPTITWNKDGVQVTESGkfhispegYLAIRDVGVADQGRYECVARNT 58
Ig3_Contactin_like cd04968
Third Ig domain of contactin; Ig3_Contactin_like: Third Ig domain of contactins. Contactins ...
451-529 8.82e-04

Third Ig domain of contactin; Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnatal, and a lack of contactin-5 (NB-2) results in an impairment of neuronal act ivity in the rat auditory system. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.


Pssm-ID: 143169  Cd Length: 88  Bit Score: 38.23  E-value: 8.82e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056 451 KPKSgTSWTEGDEVMLTCSARGFPEPKLTWSqRGDttpaEPPFEGRGWMSSSLTLKVTS-ALSREGV-SCEASNIHGKNG 528
Cdd:cd04968   7 FPKD-TYALKGQNVTLECFALGNPVPQIKWR-KVD----GSMPSSAEISMSGAVLKIPNiQFEDEGTyECEAENIKGKDT 80

                .
gi 13929056 529 H 529
Cdd:cd04968  81 H 81
Ig5_NCAM-2 cd05870
Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as ...
445-531 1.09e-03

Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM); Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2 is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.


Pssm-ID: 143278  Cd Length: 98  Bit Score: 38.03  E-value: 1.09e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056 445 LKPNEIKPKSGTSWtEGDEVMLTCSARGFPEPKLTWSQ--------RGDTTPaEPPFEGRG-WMSSSLTLKVTSaLSREG 515
Cdd:cd05870   1 VQPHIIQLKNETTV-ENGAATLSCKAEGEPIPEITWKRasdghtfsEGDKSP-DGRIEVKGqHGESSLHIKDVK-LSDSG 77
                        90
                ....*....|....*...
gi 13929056 516 -VSCEA-SNIHGKNGHVF 531
Cdd:cd05870  78 rYDCEAaSRIGGHQKSMY 95
Ig3_Contactin_like cd04968
Third Ig domain of contactin; Ig3_Contactin_like: Third Ig domain of contactins. Contactins ...
357-421 1.14e-03

Third Ig domain of contactin; Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnatal, and a lack of contactin-5 (NB-2) results in an impairment of neuronal act ivity in the rat auditory system. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.


Pssm-ID: 143169  Cd Length: 88  Bit Score: 37.84  E-value: 1.14e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 13929056 357 PLELSVPEEFSVFLNSSGTVvNCSARGLPAPIVRWTK-------DSVTVADGPILSLDSVTFDSAGTYTCEA 421
Cdd:cd04968   2 SIIVVFPKDTYALKGQNVTL-ECFALGNPVPQIKWRKvdgsmpsSAEISMSGAVLKIPNIQFEDEGTYECEA 72
Ig1_Contactin-1 cd05849
First Ig domain of contactin-1; Ig1_Contactin-1: First Ig domain of the neural cell adhesion ...
357-422 1.31e-03

First Ig domain of contactin-1; Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.


Pssm-ID: 143257  Cd Length: 93  Bit Score: 37.63  E-value: 1.31e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 13929056 357 PLELSVPEEfsvflNSSGTV-VNCSARGLPAPIVRW---------TKDSVTVADGPILSLDSVTFDSAGTYTCEAS 422
Cdd:cd05849   8 PIDTIYPEE-----STEGKVsVNCRARANPFPIYKWrknnldidlTNDRYSMVGGNLVINNPDKYKDAGRYVCIVS 78
Ig_2 pfam13895
Immunoglobulin domain; This domain contains immunoglobulin-like domains.
459-484 1.39e-03

Immunoglobulin domain; This domain contains immunoglobulin-like domains.


Pssm-ID: 258162  Cd Length: 80  Bit Score: 37.39  E-value: 1.39e-03
                          10        20
                  ....*....|....*....|....*.
gi 13929056   459 TEGDEVMLTCSARGFPEPKLTWSQRG 484
Cdd:pfam13895  12 FEGEDVTLTCSAPGNPPPNYTWYKDG 37
Ig_2 pfam13895
Immunoglobulin domain; This domain contains immunoglobulin-like domains.
275-333 1.44e-03

Immunoglobulin domain; This domain contains immunoglobulin-like domains.


Pssm-ID: 258162  Cd Length: 80  Bit Score: 37.39  E-value: 1.44e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 13929056   275 VREGDAVQLLCQGDGSPSPEYSFFREqgnqEEQLNVNLKGNLTLEgVHRSQSGIYGCRV 333
Cdd:pfam13895  11 VFEGEDVTLTCSAPGNPPPNYTWYKD----GTALSSSQNGSFTPN-VSESDSGTYTCTA 64
Ig4_Contactin-2-like cd05728
Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins; ...
264-335 1.71e-03

Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins; Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.


Pssm-ID: 143205  Cd Length: 85  Bit Score: 37.19  E-value: 1.71e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056 264 WVGSPSTTEGWVreGDAVQLLCQGDGSPSPEYSFFR--EQGNQEEQLNVnLKGNLTLEGVHRSQSGIYGCRVED 335
Cdd:cd05728   2 WLKVISDTEADI--GSSLRWECKASGNPRPAYRWLKngQPLASENRIEV-EAGDLRITKLSLSDSGMYQCVAEN 72
IgC cd00098
Immunoglobulin Constant domain; IgC: Immunoglobulin constant domain (IgC). Members of the IgC ...
456-521 2.15e-03

Immunoglobulin Constant domain; IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.


Pssm-ID: 143166  Cd Length: 95  Bit Score: 37.05  E-value: 2.15e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 13929056 456 TSWTEGDEVMLTCSARGF--PEPKLTWSQRG-----DTTPAEPPFEGRG--WMSSSLTLKVTSALSREGVSCEAS 521
Cdd:cd00098   8 PEELLGGSVTLTCLATGFypPDITVTWLKNGkeltsGVTTTPPVPNSDGtySVSSQLTVSPSDWNSGDTYTCVVT 82
Ig cd00096
Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
165-243 2.25e-03

Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 143165 [Multi-domain]  Cd Length: 74  Bit Score: 36.70  E-value: 2.25e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 13929056 165 TCSSNnGNPVPRITWYQNGQRLDVPmelnskgymTSRTVREASGLYSLTSTLYLRLHKEDRDASFHCAAHYDLPSGQHG 243
Cdd:cd00096   4 TCLAS-GPPPPTITWLKNGKPLPSS---------VLTRVRSSRGTSSGSSTLTISNVTLEDSGTYTCVASNSAGTVSAS 72
Ig2_KIRREL3-like cd05759
Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known ...
165-241 2.35e-03

Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2); Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.


Pssm-ID: 143236  Cd Length: 82  Bit Score: 36.66  E-value: 2.35e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 13929056 165 TCSSNNGNPVPRITWYQNGQRLDvpmelnskGYMTSRTVREASGLYSLTSTLYLRLHKEDRDASFHC-AAHYDLPSGQ 241
Cdd:cd05759   5 TCRARGAKPAAEIIWFRDGEVLD--------GATYSKELLKDGKRETTVSTLPITPSDHDTGRTFTCrARNEALPTGK 74
Ig4_L1-CAM_like cd05867
Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM); Ig4_L1-CAM_like: ...
461-531 2.48e-03

Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM); Ig4_L1-CAM_like: fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.


Pssm-ID: 143275 [Multi-domain]  Cd Length: 76  Bit Score: 36.79  E-value: 2.48e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 13929056 461 GDEVMLTCSARGFPEPKLTWSQRGDTTPAEPPfEGRGWMSSSLTLKVTSALSREGV-SCEASNIHGK---NGHVF 531
Cdd:cd05867   1 GETARLDCQVEGIPTPNITWSINGAPIEGTDP-DPRRHVSSGALILTDVQPSDTAVyQCEARNRHGNllaNAHVH 74
Ig2_VEGFR cd04976
Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR); ...
382-439 2.82e-03

Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR); Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis. VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells. VEGFR-3 has been shown to be involved in tumor angiogenesis and growth.


Pssm-ID: 143177  Cd Length: 71  Bit Score: 36.23  E-value: 2.82e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 13929056 382 RGLPAPIVRWTKD-------SVTVADGPILSLDSVTFDSAGTYTCEASTPTVPLLSRtQSFQLVV 439
Cdd:cd04976   8 KAYPPPEIQWYKNgklisekNRTKKSGHSLTIKDVTEEDAGNYTVVLTNKQAKLEKR-LTFTLVV 71
Ig2_Follistatin_like cd05736
Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya ...
377-423 2.89e-03

Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins; Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution. They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.


Pssm-ID: 143213  Cd Length: 76  Bit Score: 36.44  E-value: 2.89e-03
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 13929056 377 VNCSARGLPAPIVRWTKDSVTV-----------ADGPILSLDSVTFDSAGTYTCEAST 423
Cdd:cd05736   3 LRCHAEGIPLPRLTWLKNGMDItpklskqltliANGSELHISNVRYEDTGAYTCIAKN 60
Ig6_L1-CAM_like cd05733
Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar ...
376-422 3.14e-03

Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins; Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.


Pssm-ID: 143210  Cd Length: 77  Bit Score: 36.21  E-value: 3.14e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 13929056 376 VVNCSARGLPAPIVRWTKDSVT--VADGPILSL--DSVTF-----------DSAGTYTCEAS 422
Cdd:cd05733   2 VIKCEAKGNPPPTFSWTRNGTHfdPEKDPRVTMkpDSGTLvidnmnggraeDYEGEYQCYAS 63
Ig2_FGFR_like cd05729
Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar ...
379-422 3.18e-03

Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins; Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans. This group also contains fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.


Pssm-ID: 143206 [Multi-domain]  Cd Length: 85  Bit Score: 36.21  E-value: 3.18e-03
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 13929056 379 CSARGLPAPIVRWTKDSVT-VADGPI-----------LSLDSVTFDSAGTYTCEAS 422
Cdd:cd05729  16 CPASGNPRPTITWLKDGKPfKKEHRIggykvrkkkwtLILESVVPSDSGKYTCIVE 71
Ig4_L1-NrCAM_like cd04978
Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), ...
376-429 3.97e-03

Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related); Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.


Pssm-ID: 143179 [Multi-domain]  Cd Length: 76  Bit Score: 35.84  E-value: 3.97e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056 376 VVNCSARGLPAPIVRWT----------KDSVTVADGPILSLDSVTFDSAGTYTCEASTPTVPLL 429
Cdd:cd04978   5 RLDCEAEGIPQPTITWRlngvpieelpPDPRRRVDGGTLILSNVQPNDTAVYQCNASNVHGYLL 68
ig pfam00047
Immunoglobulin domain; Members of the immunoglobulin superfamily are found in hundreds of ...
379-421 4.01e-03

Immunoglobulin domain; Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.


Pssm-ID: 249539  Cd Length: 62  Bit Score: 35.98  E-value: 4.01e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 13929056   379 CSARGLPAPIVRWTKD------------SVTVADGPILSLDSVTFDSAGTYTCEA 421
Cdd:pfam00047   8 CSVSGPPQVDVTWFKEgkgleesttvgtDTNRVSSITLTISNVTPEDSGTYTCVV 62
Ig3_Peroxidasin cd05745
Third immunoglobulin (Ig)-like domain of peroxidasin; Ig3_Peroxidasin: the third ...
460-525 4.13e-03

Third immunoglobulin (Ig)-like domain of peroxidasin; Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.


Pssm-ID: 143222  Cd Length: 74  Bit Score: 36.07  E-value: 4.13e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 13929056 460 EGDEVMLTCSARGFPEPKLTWSQRGdttpAEPPFEGRGWMSSSLTLKVTS-ALSREG-VSCEASNIHG 525
Cdd:cd05745   1 EGQTVDFLCEAQGYPQPVIAWTKGG----SQLSVDRRHLVLSSGTLRISRvALHDQGqYECQAVNIVG 64
Ig cd00096
Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
281-334 4.14e-03

Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 143165 [Multi-domain]  Cd Length: 74  Bit Score: 35.93  E-value: 4.14e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 13929056 281 VQLLCQGDGSPSPEYSFFREQGNQEEQLNVNLK---------GNLTLEGVHRSQSGIYGCRVE 334
Cdd:cd00096   1 VTLTCLASGPPPPTITWLKNGKPLPSSVLTRVRssrgtssgsSTLTISNVTLEDSGTYTCVAS 63
Ig5_NCAM-1 cd05869
Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM); ...
462-533 4.17e-03

Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM); Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans interactions), through binding to the Ig1 and Ig2 domains. The adhesive ability of NCAM is modulated by the addition of polysialic acid chains to the fifth Ig-like domain.


Pssm-ID: 143277  Cd Length: 97  Bit Score: 36.11  E-value: 4.17e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 13929056 462 DEVMLTCSARGFPEPKLTWS-QRGDTTPAEPPFEGRGWMS-----SSLTLKVTSALSREGVSCEASNIHGKNGHVFHF 533
Cdd:cd05869  18 EQITLTCEASGDPIPSITWRtSTRNISSEEKTLDGHIVVRsharvSSLTLKYIQYTDAGEYLCTASNTIGQDSQSMYL 95
Ig3_L1-CAM_like cd05731
Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM); Ig3_L1-CAM_like: ...
376-424 4.18e-03

Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM); Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.


Pssm-ID: 143208  Cd Length: 71  Bit Score: 35.81  E-value: 4.18e-03
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 13929056 376 VVNCSARGLPAPIVRWTK-------DSVTVAD-GPILSLDSVTFDSAGTYTCEASTP 424
Cdd:cd05731   2 LLECIAEGLPTPEISWIKiggelpaDRTKFENfNKTLKIDNVSEEDDGEYRCTASNS 58
Ig1_Neogenin cd05722
First immunoglobulin (Ig)-like domain in neogenin and similar proteins; Ig1_Neogenin: first ...
376-432 4.32e-03

First immunoglobulin (Ig)-like domain in neogenin and similar proteins; Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.


Pssm-ID: 143199  Cd Length: 95  Bit Score: 35.92  E-value: 4.32e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 13929056 376 VVNCSARGLPAPIVRWTKDSVTV-----------ADGPIL--SLDSVTFDSA--GTYTCEASTPTV-PLLSRT 432
Cdd:cd05722  18 VLNCSAEGEPPPKIEWKKDGVLLnlvsderrqqlPNGSLLitSVVHSKHNKPdeGFYQCVAQNDSLgSIVSRT 90
Ig2_Necl-1-4_like cd05761
Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also ...
165-240 4.58e-03

Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively); Ig2_Necl-1-4_like: domain similar to the second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), Necl-3 (CADM2) and Necl-4 (CADM4). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue and is important to the formation of synapses, axon bundles, and myelinated axons. Necl-2 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Necl-3 has been shown to accumulate in tissues of the central and peripheral nervous system, where it is expressed in ependymal cells and myelinated axons. It is observed at the interface between the axon shaft and the myelin sheath. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination. Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.


Pssm-ID: 143238  Cd Length: 82  Bit Score: 35.77  E-value: 4.58e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 13929056 165 TCSSNNGNPVPRITWYQNgqrldvPMELNSKgymtSRTVREASG-LYSLTSTLYLRLHKEDRDASFHCAA-HYDLPSG 240
Cdd:cd05761   5 TCTSSGSKPAATIRWFKG------DKELKGV----KLKEEDENGkTFTVTSSLRFQVDREDDGAPIICRVdHPALKST 72
Ig1_Robo cd07693
First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins; ...
171-234 5.94e-03

First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins; Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagonizes slit responsiveness in precrossing axons. The Slit-Robo interaction is mediated by the second leucine-rich repeat (LRR) domain of Slit and the two N-terminal Ig domains of Robo, Ig1 and Ig2. The primary Robo binding site for Slit2 has been shown by surface plasmon resonance experiments and mutational analysis to be is the Ig1 domain, while the Ig2 domain has been proposed to harbor a weak secondary binding site.


Pssm-ID: 143317  Cd Length: 100  Bit Score: 35.60  E-value: 5.94e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056 171 GNPVPRITWYQNGQRLDVPMELNSkgymTSRTVREASGLYSLtSTLYLRLHKEDrDASFHCAAH 234
Cdd:cd07693  27 GRPTPTIQWLKNGQPLETDKDDPR----SHRIVLPSGSLFFL-RVVHGRKGRSD-EGVYVCVAH 84
Ig_Myomesin_like_C cd05737
C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein; Ig_Myomesin_like_C: ...
275-345 6.92e-03

C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein; Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.


Pssm-ID: 143214  Cd Length: 92  Bit Score: 35.18  E-value: 6.92e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 13929056 275 VREGDAVQLLCQGDGSPSPEYSFFR-EQG-NQEEQLNVNLKG----NLTLEGVHRSQSGIYGCRVEDYDADEEVQLV 345
Cdd:cd05737  13 IMEGKTLNLTCTVFGDPDPEVSWLKnDQAlALSDHYNVKVEQgkyaSLTIKGVSSEDSGKYGIVVKNKYGGETVDVT 89
IGc2 smart00408
Immunoglobulin C-2 Type;
277-335 4.11e-07

Immunoglobulin C-2 Type;


Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 47.79  E-value: 4.11e-07
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056    277 EGDAVQLLCQGDGSPSPEYSFFREQGNQEEQLNVNLKGN-LTLEGVHRSQSGIYGCRVED 335
Cdd:smart00408   1 EGQSVTLTCPAEGNPVPNITWLKDGKPLPESNRFVASGStLTIKSVSLEDSGLYTCVAEN 60
IGc2 smart00408
Immunoglobulin C-2 Type;
460-525 3.82e-05

Immunoglobulin C-2 Type;


Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 42.01  E-value: 3.82e-05
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 13929056    460 EGDEVMLTCSARGFPEPKLTWSQRGDTTPaeppfEGRGWMSSSLTLKVTSA-LSREGV-SCEASNIHG 525
Cdd:smart00408   1 EGQSVTLTCPAEGNPVPNITWLKDGKPLP-----ESNRFVASGSTLTIKSVsLEDSGLyTCVAENSAG 63
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
32-137 1.12e-03

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653 [Multi-domain]  Cd Length: 85  Bit Score: 37.87  E-value: 1.12e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056     32 PPRVEVMRGEQIALDCTPREHPENYVlEWLLvdasgarhrlasvepQGSEFLGTIHNSRGRRPPykidSLGRLVIAEAQV 111
Cdd:smart00410   1 PPSVTVKEGESVTLSCEASGSPPPEV-TWYK---------------QGGKLLAESGRFSVSRSG----STSTLTISNVTP 60
                           90       100
                   ....*....|....*....|....*.
gi 13929056    112 GDERDYVCVVKAGaAGTSEATSSVRV 137
Cdd:smart00410  61 EDSGTYTCAATNS-SGSASSGTTLTV 85
IGc2 smart00408
Immunoglobulin C-2 Type;
376-424 1.16e-08

Immunoglobulin C-2 Type;


Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 52.41  E-value: 1.16e-08
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 13929056    376 VVNCSARGLPAPIVRWTKDS-------VTVADGPILSLDSVTFDSAGTYTCEASTP 424
Cdd:smart00408   6 TLTCPAEGNPVPNITWLKDGkplpesnRFVASGSTLTIKSVSLEDSGLYTCVAENS 61
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
454-526 1.48e-06

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653 [Multi-domain]  Cd Length: 85  Bit Score: 46.73  E-value: 1.48e-06
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 13929056    454 SGTSWTEGDEVMLTCSARGFPEPKLTWSQRGDTTPAEPPFEGRGWMSSSLTLKVTSALSR-EGV-SCEASNIHGK 526
Cdd:smart00410   2 PSVTVKEGESVTLSCEASGSPPPEVTWYKQGGKLLAESGRFSVSRSGSTSTLTISNVTPEdSGTyTCAATNSSGS 76
IG smart00409
Immunoglobulin;
454-526 1.48e-06

Immunoglobulin;


Pssm-ID: 214652 [Multi-domain]  Cd Length: 85  Bit Score: 46.73  E-value: 1.48e-06
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 13929056    454 SGTSWTEGDEVMLTCSARGFPEPKLTWSQRGDTTPAEPPFEGRGWMSSSLTLKVTSALSR-EGV-SCEASNIHGK 526
Cdd:smart00409   2 PSVTVKEGESVTLSCEASGSPPPEVTWYKQGGKLLAESGRFSVSRSGSTSTLTISNVTPEdSGTyTCAATNSSGS 76
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
274-341 6.78e-06

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653 [Multi-domain]  Cd Length: 85  Bit Score: 44.42  E-value: 6.78e-06
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056    274 WVREGDAVQLLCQGDGSPSPEYSFFREQGNQ------EEQLNVNLKGNLTLEGVHRSQSGIYGCRVEDYDADEE 341
Cdd:smart00410   5 TVKEGESVTLSCEASGSPPPEVTWYKQGGKLlaesgrFSVSRSGSTSTLTISNVTPEDSGTYTCAATNSSGSAS 78
IG smart00409
Immunoglobulin;
274-341 6.78e-06

Immunoglobulin;


Pssm-ID: 214652 [Multi-domain]  Cd Length: 85  Bit Score: 44.42  E-value: 6.78e-06
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056    274 WVREGDAVQLLCQGDGSPSPEYSFFREQGNQ------EEQLNVNLKGNLTLEGVHRSQSGIYGCRVEDYDADEE 341
Cdd:smart00409   5 TVKEGESVTLSCEASGSPPPEVTWYKQGGKLlaesgrFSVSRSGSTSTLTISNVTPEDSGTYTCAATNSSGSAS 78
I-set pfam07679
Immunoglobulin I-set domain;
449-526 1.57e-04

Immunoglobulin I-set domain;


Pssm-ID: 254352 [Multi-domain]  Cd Length: 90  Bit Score: 40.32  E-value: 1.57e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056   449 EIKPKSGTSwTEGDEVMLTCSARGFPEPKLTWSQRGDTTPAEPPFEGRgWMSSSLTLKVTSA-LSREGV-SCEASNIHGK 526
Cdd:pfam07679   4 TQKPKDVEV-QEGESARFTCTVTGTPDPEVSWFKDGQPLRSSDRFKVT-YEGGTYTLTISNVqPDDSGKyTCVATNSAGE 81
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
376-439 1.99e-04

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653 [Multi-domain]  Cd Length: 85  Bit Score: 40.18  E-value: 1.99e-04
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 13929056    376 VVNCSARGLPAPIVRWTKDSVTVADGP------------ILSLDSVTFDSAGTYTCEASTPTVpllSRTQSFQLVV 439
Cdd:smart00410  13 TLSCEASGSPPPEVTWYKQGGKLLAESgrfsvsrsgstsTLTISNVTPEDSGTYTCAATNSSG---SASSGTTLTV 85
IG smart00409
Immunoglobulin;
376-439 1.99e-04

Immunoglobulin;


Pssm-ID: 214652 [Multi-domain]  Cd Length: 85  Bit Score: 40.18  E-value: 1.99e-04
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 13929056    376 VVNCSARGLPAPIVRWTKDSVTVADGP------------ILSLDSVTFDSAGTYTCEASTPTVpllSRTQSFQLVV 439
Cdd:smart00409  13 TLSCEASGSPPPEVTWYKQGGKLLAESgrfsvsrsgstsTLTISNVTPEDSGTYTCAATNSSG---SASSGTTLTV 85
I-set pfam07679
Immunoglobulin I-set domain;
360-422 3.61e-04

Immunoglobulin I-set domain;


Pssm-ID: 254352 [Multi-domain]  Cd Length: 90  Bit Score: 39.16  E-value: 3.61e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 13929056   360 LSVPEEFSVFLNssgtvvnCSARGLPAPIVRWTKDSVTVADGPI-----------LSLDSVTFDSAGTYTCEAS 422
Cdd:pfam07679  10 VEVQEGESARFT-------CTVTGTPDPEVSWFKDGQPLRSSDRfkvtyeggtytLTISNVQPDDSGKYTCVAT 76
I-set pfam07679
Immunoglobulin I-set domain;
275-334 9.89e-04

Immunoglobulin I-set domain;


Pssm-ID: 254352 [Multi-domain]  Cd Length: 90  Bit Score: 38.01  E-value: 9.89e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 13929056   275 VREGDAVQLLCQGDGSPSPEYSFFR--EQGNQEEQLNVNLKGN---LTLEGVHRSQSGIYGCRVE 334
Cdd:pfam07679  12 VQEGESARFTCTVTGTPDPEVSWFKdgQPLRSSDRFKVTYEGGtytLTISNVQPDDSGKYTCVAT 76
IG smart00409
Immunoglobulin;
32-137 1.12e-03

Immunoglobulin;


Pssm-ID: 214652 [Multi-domain]  Cd Length: 85  Bit Score: 37.87  E-value: 1.12e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056     32 PPRVEVMRGEQIALDCTPREHPENYVlEWLLvdasgarhrlasvepQGSEFLGTIHNSRGRRPPykidSLGRLVIAEAQV 111
Cdd:smart00409   1 PPSVTVKEGESVTLSCEASGSPPPEV-TWYK---------------QGGKLLAESGRFSVSRSG----STSTLTISNVTP 60
                           90       100
                   ....*....|....*....|....*.
gi 13929056    112 GDERDYVCVVKAGaAGTSEATSSVRV 137
Cdd:smart00409  61 EDSGTYTCAATNS-SGSASSGTTLTV 85
I-set pfam07679
Immunoglobulin I-set domain;
29-137 2.13e-03

Immunoglobulin I-set domain;


Pssm-ID: 254352 [Multi-domain]  Cd Length: 90  Bit Score: 36.85  E-value: 2.13e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13929056    29 VSVPPRVEVMRGEQIALDCTPREHPENYVlEWLLVD---ASGARHRlasvepqgseflgtIHNSRGRrppykidslGRLV 105
Cdd:pfam07679   4 TQKPKDVEVQEGESARFTCTVTGTPDPEV-SWFKDGqplRSSDRFK--------------VTYEGGT---------YTLT 59
                          90       100       110
                  ....*....|....*....|....*....|..
gi 13929056   106 IAEAQVGDERDYVCVVKaGAAGTSEATSSVRV 137
Cdd:pfam07679  60 ISNVQPDDSGKYTCVAT-NSAGEAEASAELTV 90
IGc2 smart00408
Immunoglobulin C-2 Type;
165-211 7.71e-03

Immunoglobulin C-2 Type;


Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 35.08  E-value: 7.71e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 13929056    165 TCSSNnGNPVPRITWYQNGQRLDVPMELN-SKGYMTSRTVREA-SGLYS 211
Cdd:smart00408   8 TCPAE-GNPVPNITWLKDGKPLPESNRFVaSGSTLTIKSVSLEdSGLYT 55
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH