NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|13540665|ref|NP_110478|]
View 

B1 bradykinin receptor [Rattus norvegicus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
80-322 1.90e-47

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


:

Pssm-ID: 278431 [Multi-domain]  Cd Length: 254  Bit Score: 162.48  E-value: 1.90e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665    80 TIAEIYLANLAASDLVF-VLGLPFWAENIGNrFNWPFGTDLCRVVSGVIKANLFVSIFLVVAISQDRYRLLVYPMtsWGY 158
Cdd:pfam00001  17 TPTNIFLLNLAVADLLFlLLTLPFWLVYALF-GTWPFGSALCKLVTALDVVNGYASILLLTAISIDRYLAIVHPL--RYR 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665   159 RRRRQAQATCLLIWVAGGLLSIPTFLLRSVKVVPDLNVSACILLFPHEAWHFARMVELNVLGFLLPVTAIIFFNYHILAS 238
Cdd:pfam00001  94 RIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIPSNGVTSCLITFPESLWPVSYLLFSTVVGFLLPLLVILVCYTRIIRT 173
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665   239 LRgqKEASRTRCGGPKGSKTTGLILTLVASFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEITDLgLQLANFFAFVNSCLN 318
Cdd:pfam00001 174 LR--KQARSRRRSVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDLLIIISCVVTPPRTL-LQLTVWLAYSNSCLN 250

                  ....
gi 13540665   319 PLIY 322
Cdd:pfam00001 251 PIIY 254
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
80-322 1.90e-47

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431 [Multi-domain]  Cd Length: 254  Bit Score: 162.48  E-value: 1.90e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665    80 TIAEIYLANLAASDLVF-VLGLPFWAENIGNrFNWPFGTDLCRVVSGVIKANLFVSIFLVVAISQDRYRLLVYPMtsWGY 158
Cdd:pfam00001  17 TPTNIFLLNLAVADLLFlLLTLPFWLVYALF-GTWPFGSALCKLVTALDVVNGYASILLLTAISIDRYLAIVHPL--RYR 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665   159 RRRRQAQATCLLIWVAGGLLSIPTFLLRSVKVVPDLNVSACILLFPHEAWHFARMVELNVLGFLLPVTAIIFFNYHILAS 238
Cdd:pfam00001  94 RIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIPSNGVTSCLITFPESLWPVSYLLFSTVVGFLLPLLVILVCYTRIIRT 173
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665   239 LRgqKEASRTRCGGPKGSKTTGLILTLVASFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEITDLgLQLANFFAFVNSCLN 318
Cdd:pfam00001 174 LR--KQARSRRRSVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDLLIIISCVVTPPRTL-LQLTVWLAYSNSCLN 250

                  ....
gi 13540665   319 PLIY 322
Cdd:pfam00001 251 PIIY 254
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
44-327 1.62e-33

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 126.82  E-value: 1.62e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665   44 ITICFFGLLGNLLVLSFfllpwrqwwwqqRQRQQRLTIAEIYLANLAASDLVFVLGLPFWAENIgNRFNWPFGTDLCRVV 123
Cdd:PHA03087  48 STIFFFGLVGNIIVIYV------------LTKTKIKTPMDIYLLNLAVSDLLFVMTLPFQIYYY-ILFQWSFGEFACKIV 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665  124 SGVIKANLFVSIFLVVAISQDRYRLLVYPMTSWGYRRRRQAQATCLLIWVAGGLLSIPTFLLRSVKvvPDLNVSACILLF 203
Cdd:PHA03087 115 SGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTK--KDHETLICCMFY 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665  204 PHEA--WHFARMVELNVLGFLLPVTAIIFFNYHILASLRGQKEASRTRcggpkgsKTTGLILTLVASFLVCWCPYHFFAF 281
Cdd:PHA03087 193 NNKTmnWKLFINFEINIIGMLIPLTILLYCYSKILITLKGINKSKKNK-------KAIKLVLIIVILFVIFWLPFNVSVF 265
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 13540665  282 LDFLVQVRVIQDCSWKEITDLGLQLANFFAFVNSCLNPLIYVFAGR 327
Cdd:PHA03087 266 VYSLHILHFKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSE 311
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
80-322 1.90e-47

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431 [Multi-domain]  Cd Length: 254  Bit Score: 162.48  E-value: 1.90e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665    80 TIAEIYLANLAASDLVF-VLGLPFWAENIGNrFNWPFGTDLCRVVSGVIKANLFVSIFLVVAISQDRYRLLVYPMtsWGY 158
Cdd:pfam00001  17 TPTNIFLLNLAVADLLFlLLTLPFWLVYALF-GTWPFGSALCKLVTALDVVNGYASILLLTAISIDRYLAIVHPL--RYR 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665   159 RRRRQAQATCLLIWVAGGLLSIPTFLLRSVKVVPDLNVSACILLFPHEAWHFARMVELNVLGFLLPVTAIIFFNYHILAS 238
Cdd:pfam00001  94 RIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIPSNGVTSCLITFPESLWPVSYLLFSTVVGFLLPLLVILVCYTRIIRT 173
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665   239 LRgqKEASRTRCGGPKGSKTTGLILTLVASFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEITDLgLQLANFFAFVNSCLN 318
Cdd:pfam00001 174 LR--KQARSRRRSVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDLLIIISCVVTPPRTL-LQLTVWLAYSNSCLN 250

                  ....
gi 13540665   319 PLIY 322
Cdd:pfam00001 251 PIIY 254
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
44-327 1.62e-33

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 126.82  E-value: 1.62e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665   44 ITICFFGLLGNLLVLSFfllpwrqwwwqqRQRQQRLTIAEIYLANLAASDLVFVLGLPFWAENIgNRFNWPFGTDLCRVV 123
Cdd:PHA03087  48 STIFFFGLVGNIIVIYV------------LTKTKIKTPMDIYLLNLAVSDLLFVMTLPFQIYYY-ILFQWSFGEFACKIV 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665  124 SGVIKANLFVSIFLVVAISQDRYRLLVYPMTSWGYRRRRQAQATCLLIWVAGGLLSIPTFLLRSVKvvPDLNVSACILLF 203
Cdd:PHA03087 115 SGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTK--KDHETLICCMFY 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665  204 PHEA--WHFARMVELNVLGFLLPVTAIIFFNYHILASLRGQKEASRTRcggpkgsKTTGLILTLVASFLVCWCPYHFFAF 281
Cdd:PHA03087 193 NNKTmnWKLFINFEINIIGMLIPLTILLYCYSKILITLKGINKSKKNK-------KAIKLVLIIVILFVIFWLPFNVSVF 265
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 13540665  282 LDFLVQVRVIQDCSWKEITDLGLQLANFFAFVNSCLNPLIYVFAGR 327
Cdd:PHA03087 266 VYSLHILHFKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSE 311
PHA02638 PHA02638
CC chemokine receptor-like protein; Provisional
42-334 9.42e-25

CC chemokine receptor-like protein; Provisional


Pssm-ID: 165021 [Multi-domain]  Cd Length: 417  Bit Score: 102.40  E-value: 9.42e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665   42 FVITICFFGLLGNLLVLSFFLLPWRQwwwqqrqrqqrlTIAEIYLANLAASDLVFVLGLPFWaenIGNRFN-WPFGTDLC 120
Cdd:PHA02638 104 FYIIIFILGLFGNAAIIMILFCKKIK------------TITDIYIFNLAISDLIFVIDFPFI---IYNEFDqWIFGDFMC 168
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665  121 RVVSGVIKANLFVSIFLVVAISQDRYRLLVYPMTSWGYRRRRQAQATCLLIWVAGGLLSIPT-FLLRSVKVVPDLNVS-- 197
Cdd:PHA02638 169 KVISASYYIGFFSNMFLITLMSIDRYFAILYPISFQKYRTFNIGIILCIISWILSLIITSPAyFIFEASNIIFSAQDSne 248
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665  198 -----ACILLFPHEAWHFA---RMV--ELNVLGFLLPVTAIIFFNYHILASLRGQKEASRTrcggpkgsKTTGLILTLVA 267
Cdd:PHA02638 249 tisnyQCTLIEDNEKNNISflgRILqfEINILGMFIPIIIFAFCYIKIILKLKQLKKSKKT--------KSIIIVSIIII 320
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 13540665  268 SFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEITDL-----GLQLANFFAFVNSCLNPLIYVFAGRLLKTRVL 334
Cdd:PHA02638 321 CSLICWIPLNIVILFATMYSFKGFNSIISEHICGFiklgyAMMLAEAISLTHCCINPLIYTLIGENFRMHLL 392
PHA02834 PHA02834
chemokine receptor-like protein; Provisional
42-327 1.03e-22

chemokine receptor-like protein; Provisional


Pssm-ID: 165177 [Multi-domain]  Cd Length: 323  Bit Score: 95.36  E-value: 1.03e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665   42 FVITICFFGLLGNLLVLSFFLLPWRqwwwqqrqrqqrLTIAEIYLANLAASDLVFVLGLPFWAENIGNRfnWPFGTDLCR 121
Cdd:PHA02834  34 FYILLFIFGLIGNVLVIAVLIVKRF------------MFVVDVYLFNIAMSDLMLVFSFPFIIHNDLNE--WIFGEFMCK 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665  122 VVSGVIKANLFVSIFLVVAISQDRYrLLVYPMTSWGYRRRRQAQATCLLIWVAGGLLSIPTFLLRSVKVVPDLNvsACIL 201
Cdd:PHA02834 100 LVLGVYFVGFFSNMFFVTLISIDRY-ILVVNATKIKNKSISLSVLLSVAAWVCSVILSMPAMVLYYVDNTDNLK--QCIF 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665  202 LFPHE--AWHFARMVELNVLGFLLPVTAIIFFNYHILASLRGQKEASRTRcggpkgskTTGLILTLVASFLVCWCPYHFF 279
Cdd:PHA02834 177 NDYHEnfSWSAFFNFEINIFGIVIPLIILIYCYSKILYTLKNCKNKNKTR--------SIKIILTVVTFTVVFWVPFNIV 248
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*....
gi 13540665  280 AFLDFLVQVRVIQ-DCSWKEITDLGLQLANFFAFVNSCLNPLIYVFAGR 327
Cdd:PHA02834 249 LFINSLQSVGLIDiGCYHFKKIVYSIDIAELISFVHCCVNPIIYAFVGK 297
PHA03235 PHA03235
DNA packaging protein UL33; Provisional
82-332 3.19e-08

DNA packaging protein UL33; Provisional


Pssm-ID: 223017 [Multi-domain]  Cd Length: 409  Bit Score: 53.28  E-value: 3.19e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665   82 AEIYLANLAASDLVFVLGLPFWAenIGNRFNWPFGTDLCRVVSGVIKANLFVSIFLVVAISQDRYRLLvYPMTSWGYRRR 161
Cdd:PHA03235  69 PTLYMTNLYLANLLTVFVLPFIM--LSNQGLLSGSVAGCKFASLLYYASCTVGFATVALIAADRYRVI-HQRTRARSSAY 145
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665  162 RQAQATCLLIWVAGGLLSIPTFLLRSVKVVPDLNVSA-----CILLFPHEAWHFARM---VELNVLGFLLPVTAIIFFNY 233
Cdd:PHA03235 146 RSTYKILGLTWFASLICSGPAPVYTTVVAHDDVDPEApgyetCVIYFRADQVKTVLStfkVLLTLVWGIAPVVMMTWFYT 225
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13540665  234 HILASLRgqkeasRTRCggPKGSKTTGLILTLVASFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEITDLGLQLANFFAFV 313
Cdd:PHA03235 226 FFYRTLK------RASY--KKRSRTLTFVCILLLSFLCLQTPFVAIMIFDSYATLIWPSDCEHINLRDAVSTLSRLVPNL 297
                        250
                 ....*....|....*....
gi 13540665  314 NSCLNPLIYVFAGRLLKTR 332
Cdd:PHA03235 298 HCLLNPILYAFLGNDFLKR 316
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH