NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|13162304|ref|NP_077046|]
View 

fatty-acid amide hydrolase 1 [Rattus norvegicus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
GGCT_like super family cl18951
GGCT-like domains, also called AIG2-like family. Gamma-glutamyl cyclotransferase (GGCT) ...
99-562 7.69e-83

GGCT-like domains, also called AIG2-like family. Gamma-glutamyl cyclotransferase (GGCT) catalyzes the formation of pyroglutamic acid (5-oxoproline) from dipeptides containing gamma-glutamyl, and is a dimeric protein. In Homo sapiens, the protein is encoded by the gene C7orf24, and the enzyme participates in the gamma-glutamyl cycle. Hereditary defects in the gamma-glutamyl cycle have been described for some of the genes involved, but not for C7orf24. The synthesis and metabolism of glutathione (L-gamma-glutamyl-L-cysteinylglycine) ties the gamma-glutamyl cycle to numerous cellular processes; glutathione acts as a ubiquitous reducing agent in reductive mechanisms involved in protein and DNA synthesis, transport processes, enzyme activity, and metabolism. AIG2 (avrRpt2-induced gene) is an Arabidopsis protein that exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae pv maculicola strain ES4326 carrying avrRpt2. avrRpt2 is an avirulence gene that can convert virulent strains of P. syringae to avirulence on Arabidopsis thaliana, soybean, and bean. The family also includes bacterial tellurite-resistance proteins (trgB); tellurium (Te) compounds are used in industrial processes and had been used as antimicrobial agents in the past. Some members have been described proteins involved in cation transport (chaC).


The actual alignment was detected with superfamily member pfam01425:

Pssm-ID: 271827  Cd Length: 436  Bit Score: 268.02  E-value: 7.69e-83
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304    99 TYLGKAWEVNKGTNC-VTSYLTDCETQLSQAPRQ-------GLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVV 170
Cdd:pfam01425   5 AFLDRIEAANPKLNAfVTVFFEEALAQAKAADKRraagdklGPLHGVPISLKDNIDVKGVPTTAGSKALENYPPPYDATV 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   171 VQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCG 250
Cdd:pfam01425  85 VERLRAAGAVILGKTNMDEFAMGSTTENSAFGPTRNPWDLSRTPGGSSGGSAAAVAAGLVPLAIGTDTGGSIRIPAAFCG 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   251 ICGLKPTGNRLSKSGlkgcVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLP-FREEVYRSSRPLRVGY 329
Cdd:pfam01425 165 LVGLKPTYGRVSRYG----VVPYSSSLDQVGPLARTVEDAALLLDVISGYDPADPTSSPSPVPdFAEPLKKSLKGLRIGV 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   330 YETDN-YTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAgGLFSDGGrSFLQNFKgdfvdpclgdlILIL 408
Cdd:pfam01425 241 PREDGeYFSLDPEVQRAVLKAVAALEALGHEVVEVEPPSLKHALPLYYL-IAPAEAS-SNLSRYD-----------DLDE 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   409 RLPSWFKRLLSLLLKPLFPRLAAFLnsMRPRSAEKLWKLQHEIEMYRQSVIAQWKAmnLDVLLTP-MLGPALDLNTPGRa 487
Cdd:pfam01425 308 LYPRIRDELLGDEVKRRIELGNYAL--SAGYSGKYYLKAQKVRRLLRREFDGLFEE--LDVLLSPtTPTPAPRLGEPDD- 382
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 13162304   488 tgaiSYTVLYNCLDFPAGVVPVTTVTAEDDAqmeLYKGYFGDiwdiilkkamknsvGLPVAVQCVALPWQEELCL 562
Cdd:pfam01425 383 ----SPTVLYNLLDFTANTVPANLAGLPAIS---LPAGFSED--------------GLPVGLQIIGPPGDDETLL 436
 
Name Accession Description Interval E-value
Amidase pfam01425
Amidase;
99-562 7.69e-83

Amidase;


Pssm-ID: 250610  Cd Length: 436  Bit Score: 268.02  E-value: 7.69e-83
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304    99 TYLGKAWEVNKGTNC-VTSYLTDCETQLSQAPRQ-------GLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVV 170
Cdd:pfam01425   5 AFLDRIEAANPKLNAfVTVFFEEALAQAKAADKRraagdklGPLHGVPISLKDNIDVKGVPTTAGSKALENYPPPYDATV 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   171 VQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCG 250
Cdd:pfam01425  85 VERLRAAGAVILGKTNMDEFAMGSTTENSAFGPTRNPWDLSRTPGGSSGGSAAAVAAGLVPLAIGTDTGGSIRIPAAFCG 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   251 ICGLKPTGNRLSKSGlkgcVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLP-FREEVYRSSRPLRVGY 329
Cdd:pfam01425 165 LVGLKPTYGRVSRYG----VVPYSSSLDQVGPLARTVEDAALLLDVISGYDPADPTSSPSPVPdFAEPLKKSLKGLRIGV 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   330 YETDN-YTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAgGLFSDGGrSFLQNFKgdfvdpclgdlILIL 408
Cdd:pfam01425 241 PREDGeYFSLDPEVQRAVLKAVAALEALGHEVVEVEPPSLKHALPLYYL-IAPAEAS-SNLSRYD-----------DLDE 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   409 RLPSWFKRLLSLLLKPLFPRLAAFLnsMRPRSAEKLWKLQHEIEMYRQSVIAQWKAmnLDVLLTP-MLGPALDLNTPGRa 487
Cdd:pfam01425 308 LYPRIRDELLGDEVKRRIELGNYAL--SAGYSGKYYLKAQKVRRLLRREFDGLFEE--LDVLLSPtTPTPAPRLGEPDD- 382
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 13162304   488 tgaiSYTVLYNCLDFPAGVVPVTTVTAEDDAqmeLYKGYFGDiwdiilkkamknsvGLPVAVQCVALPWQEELCL 562
Cdd:pfam01425 383 ----SPTVLYNLLDFTANTVPANLAGLPAIS---LPAGFSED--------------GLPVGLQIIGPPGDDETLL 436
GatA COG0154
Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ...
84-578 2.13e-42

Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis]


Pssm-ID: 223232  Cd Length: 475  Bit Score: 158.61  E-value: 2.13e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  84 QKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPR----------QGLLYGVPVSLKECFSYKGHDST 153
Cdd:COG0154  14 ALLRAKELSAVELVEAYLARIEALNPDLNAFVAVDPEAALALAEAAAadarlaagepLGPLAGVPIAVKDNIDTAGLPTT 93
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304 154 LGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKS----------PGGSSGGEGA 223
Cdd:COG0154  94 AGSKALEDYVPPYDATVVERLRAAGAVILGKTNMDEFAMGSSTENSAFGPTRNPWNLERVpggssggsaaAVAAGLVPLA 173
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304 224 LigsggsplglGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLkgCVYGQTAVQlsLGPMARDVESLALclkallcehLF 303
Cdd:COG0154 174 L----------GSDTGGSIRIPAAFCGLVGLKPTYGRVSRYGV--VPLASSLDQ--IGPLARTVRDAAL---------LL 230
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304 304 TL----DPTVPPLPFREEVY-----RSSRPLRVGYY-ETDNYTMPSPAMRRALIETKQRLEAAGHTLIPF-LPNNIP-YA 371
Cdd:COG0154 231 DViagpDPRDSPLPPPPPVPpalagKDLKGLRIGVPkELGGGGPLDPDVRAAFEAAVKALEAAGAEVVEVsLPLLSDdYA 310
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304 372 LEVLSagGLFSDGGRsflqnfkGDFVDPCLGDLILILRLPSWFKRllslllkplFPRLAAFLNSMRPRSAEKLWKLQHEI 451
Cdd:COG0154 311 LAAYY--LARFDGER-------YGLRAADLYGKTRAEGFGPEVKR---------RIMLGTYLLSAGYYDAYYRRAQKTLI 372
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304 452 emyRQSVIAQWKamNLDVLLTPMLG--------PALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAeddaqmely 523
Cdd:COG0154 373 ---RRAFDKLFE--EVDVLLTPTTPtpapkigeSESDGDDPLEMYLLDVFTVPANLAGLPAISVPAGFTAD--------- 438
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|....*
gi 13162304 524 kgyfgdiwdiilkkamknsvGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQP 578
Cdd:COG0154 439 --------------------GLPVGLQLIGPAFDDATLLRLAAALEQALGWHRRP 473
PRK12470 PRK12470
amidase; Provisional
86-569 2.76e-24

amidase; Provisional


Pssm-ID: 171524  Cd Length: 462  Bit Score: 104.96  E-value: 2.76e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   86 LQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGL-------LYGVPVSLKECFSYKGHDSTLGlSL 158
Cdd:PRK12470  18 LADGELTAPMLLEVYLQRIERLDSHLRAYRVVLFDRARAEAEAAQQRLdagerlpLLGVPIAIKDDVDVAGEVTTYG-SA 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  159 NEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDI 238
Cdd:PRK12470  97 GHGPAATSDAEVVRRLRAAGAVIIGKTNVPELMIMPFTESLAFGATRNPWDPNRTPGGSSGGSAAAVAAGLAPVALGSDG 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  239 GGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTavqlSLGPMARDVESLALclkallcehLFTLDPTVPPL--PFRE 316
Cdd:PRK12470 177 GGSIRIPSTWCGLFGLKPQRDRISLEPHDGAWQGLS----VNGPIARSVMDAAL---------LLDATTTVPGPegEFVA 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  317 EVYRSSRPLRVGYyetdNYTMPSPAMRRAlieTKQRLEAaghtlipflpnnipyaleVLSAGGLFSDGGRSFLQnfkgdf 396
Cdd:PRK12470 244 AAAREPGRLRIAL----STRVPTPLPVRC---GKQELAA------------------VHQAGALLRDLGHDVVV------ 292
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  397 VDPCLGDLILILRLPSWFKRLLSLLLKPLFP-RLAAflnsmRPRSAEKL--WKLQHEIEMYRQS---VIAQWKAM--NLD 468
Cdd:PRK12470 293 RDPDYPAATYANYLPRFFRGISDDADAQAHPdRLEA-----RTRAIARLgsFFSDRRMAALRAAevvLSARIQSIfdDVD 367
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  469 VLLTPML--GP----ALD----LNTPGRATGAISYTVLYNCLDFPAGVVPvttvtaeddaqmelykgyfgdiWDIilkka 538
Cdd:PRK12470 368 VVVTPGTatGPsrigAYQrrgaVSTLLLVVQRVPYFQVWNLTGQPAAVVP----------------------WDF----- 420
                        490       500       510
                 ....*....|....*....|....*....|.
gi 13162304  539 mkNSVGLPVAVQCVALPWQEELCLRFMREVE 569
Cdd:PRK12470 421 --DGDGLPMSVQLVGRPYDEATLLALAAQIE 449
amido_AtzE TIGR02715
amidohydrolase, AtzE family; Members of this protein family are aminohydrolases related to, ...
83-570 4.47e-22

amidohydrolase, AtzE family; Members of this protein family are aminohydrolases related to, but distinct from, glutamyl-tRNA(Gln) amidotransferase subunit A. The best characterized member is the biuret hydrolase of Pseudomonas sp. ADP, which hydrolyzes ammonia from the three-nitrogen compound biuret to yield allophanate. Allophanate is also an intermediate in urea degradation by the urea carboxylase/allophanate hydrolase pathway, an alternative to urease [Unknown function, Enzymes of unknown specificity].


Pssm-ID: 233982  Cd Length: 452  Bit Score: 97.93  E-value: 4.47e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304    83 VQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTdcETQLSQAPR----------QGLLYGVPVSLKECFSYKGHDS 152
Cdd:TIGR02715   6 AGAIRSGRVSARAVAEATLARINQADGGLNAFTAVTA--ERALADAARidadlaagspLGPLAGVPFAVKNLFDVAGLTT 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   153 TLGLSLN-EGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSP 231
Cdd:TIGR02715  84 LAGAKINrDLAPAKRDATLVQRLSAAGAVLVGALNMDEFAYGFTTENAHYGPTRNPHDLTRIAGGSSGGSAAAVAAGLVP 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   232 LGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGlkgcVYGQTAVQLSLGPMARDVESLAL-------CLKALLCEHLFT 304
Cdd:TIGR02715 164 FSLGSDTNGSIRVPASLCGVFGLKPTYGRLSRQG----VFPFVASLDHVGPFARSVEDLALaydvmqgPDPQDPFCTDRP 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   305 LDPTVPPLPfreevyRSSRPLRV----GYYEtDNYTmpsPAMRRALIETKQRLEAaghTLIPFLPNN--IPYALEVLSAg 378
Cdd:TIGR02715 240 AEPTVPLLP------AGISGLRIavlgGWFQ-QNAD---PEALAAVGRVAKALGA---TTIVELPDAerARAAAFVITA- 305
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   379 glfSDGGRSFLQNFK---GDFvDPCLGD-LILILRLPSwfkrllslllkplfprlAAFLNSMRPRsaeklwklqheiEMY 454
Cdd:TIGR02715 306 ---SEGGNLHLDALRtrpQDF-DPATRDrLLAGALLPA-----------------SWYAQAQRFR------------HWF 352
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   455 RQSVIAQWKamNLDVLLTPMlgpaldlnTPGRATGAISYTVLYNCLDFPAgvvpvttvtaedDAQMELYKGYFGDIWDII 534
Cdd:TIGR02715 353 RDAIRELFQ--RVDVLIAPA--------TPCSAPLIGQETMIIDGVPVPV------------RANLGIFTQPISFAGLPV 410
                         490       500       510
                  ....*....|....*....|....*....|....*.
gi 13162304   535 LKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQ 570
Cdd:TIGR02715 411 LAAPLPRPGRLPIGVQLIAAPWREDLCLRAAAVLER 446
PLN02722 PLN02722
indole-3-acetamide amidohydrolase
236-266 1.34e-03

indole-3-acetamide amidohydrolase


Pssm-ID: 166363  Cd Length: 422  Bit Score: 39.87  E-value: 1.34e-03
                         10        20        30
                 ....*....|....*....|....*....|.
gi 13162304  236 TDIGGSIRFPSAFCGICGLKPTGNRLSKSGL 266
Cdd:PLN02722 131 TDTGGSVRVPASYCGIFGFRPSHGAVSTVGV 161
 
Name Accession Description Interval E-value
Amidase pfam01425
Amidase;
99-562 7.69e-83

Amidase;


Pssm-ID: 250610  Cd Length: 436  Bit Score: 268.02  E-value: 7.69e-83
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304    99 TYLGKAWEVNKGTNC-VTSYLTDCETQLSQAPRQ-------GLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVV 170
Cdd:pfam01425   5 AFLDRIEAANPKLNAfVTVFFEEALAQAKAADKRraagdklGPLHGVPISLKDNIDVKGVPTTAGSKALENYPPPYDATV 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   171 VQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCG 250
Cdd:pfam01425  85 VERLRAAGAVILGKTNMDEFAMGSTTENSAFGPTRNPWDLSRTPGGSSGGSAAAVAAGLVPLAIGTDTGGSIRIPAAFCG 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   251 ICGLKPTGNRLSKSGlkgcVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLP-FREEVYRSSRPLRVGY 329
Cdd:pfam01425 165 LVGLKPTYGRVSRYG----VVPYSSSLDQVGPLARTVEDAALLLDVISGYDPADPTSSPSPVPdFAEPLKKSLKGLRIGV 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   330 YETDN-YTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAgGLFSDGGrSFLQNFKgdfvdpclgdlILIL 408
Cdd:pfam01425 241 PREDGeYFSLDPEVQRAVLKAVAALEALGHEVVEVEPPSLKHALPLYYL-IAPAEAS-SNLSRYD-----------DLDE 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   409 RLPSWFKRLLSLLLKPLFPRLAAFLnsMRPRSAEKLWKLQHEIEMYRQSVIAQWKAmnLDVLLTP-MLGPALDLNTPGRa 487
Cdd:pfam01425 308 LYPRIRDELLGDEVKRRIELGNYAL--SAGYSGKYYLKAQKVRRLLRREFDGLFEE--LDVLLSPtTPTPAPRLGEPDD- 382
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 13162304   488 tgaiSYTVLYNCLDFPAGVVPVTTVTAEDDAqmeLYKGYFGDiwdiilkkamknsvGLPVAVQCVALPWQEELCL 562
Cdd:pfam01425 383 ----SPTVLYNLLDFTANTVPANLAGLPAIS---LPAGFSED--------------GLPVGLQIIGPPGDDETLL 436
GatA COG0154
Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ...
84-578 2.13e-42

Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis]


Pssm-ID: 223232  Cd Length: 475  Bit Score: 158.61  E-value: 2.13e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  84 QKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPR----------QGLLYGVPVSLKECFSYKGHDST 153
Cdd:COG0154  14 ALLRAKELSAVELVEAYLARIEALNPDLNAFVAVDPEAALALAEAAAadarlaagepLGPLAGVPIAVKDNIDTAGLPTT 93
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304 154 LGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKS----------PGGSSGGEGA 223
Cdd:COG0154  94 AGSKALEDYVPPYDATVVERLRAAGAVILGKTNMDEFAMGSSTENSAFGPTRNPWNLERVpggssggsaaAVAAGLVPLA 173
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304 224 LigsggsplglGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLkgCVYGQTAVQlsLGPMARDVESLALclkallcehLF 303
Cdd:COG0154 174 L----------GSDTGGSIRIPAAFCGLVGLKPTYGRVSRYGV--VPLASSLDQ--IGPLARTVRDAAL---------LL 230
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304 304 TL----DPTVPPLPFREEVY-----RSSRPLRVGYY-ETDNYTMPSPAMRRALIETKQRLEAAGHTLIPF-LPNNIP-YA 371
Cdd:COG0154 231 DViagpDPRDSPLPPPPPVPpalagKDLKGLRIGVPkELGGGGPLDPDVRAAFEAAVKALEAAGAEVVEVsLPLLSDdYA 310
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304 372 LEVLSagGLFSDGGRsflqnfkGDFVDPCLGDLILILRLPSWFKRllslllkplFPRLAAFLNSMRPRSAEKLWKLQHEI 451
Cdd:COG0154 311 LAAYY--LARFDGER-------YGLRAADLYGKTRAEGFGPEVKR---------RIMLGTYLLSAGYYDAYYRRAQKTLI 372
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304 452 emyRQSVIAQWKamNLDVLLTPMLG--------PALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAeddaqmely 523
Cdd:COG0154 373 ---RRAFDKLFE--EVDVLLTPTTPtpapkigeSESDGDDPLEMYLLDVFTVPANLAGLPAISVPAGFTAD--------- 438
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|....*
gi 13162304 524 kgyfgdiwdiilkkamknsvGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQP 578
Cdd:COG0154 439 --------------------GLPVGLQLIGPAFDDATLLRLAAALEQALGWHRRP 473
PRK12470 PRK12470
amidase; Provisional
86-569 2.76e-24

amidase; Provisional


Pssm-ID: 171524  Cd Length: 462  Bit Score: 104.96  E-value: 2.76e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   86 LQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGL-------LYGVPVSLKECFSYKGHDSTLGlSL 158
Cdd:PRK12470  18 LADGELTAPMLLEVYLQRIERLDSHLRAYRVVLFDRARAEAEAAQQRLdagerlpLLGVPIAIKDDVDVAGEVTTYG-SA 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  159 NEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDI 238
Cdd:PRK12470  97 GHGPAATSDAEVVRRLRAAGAVIIGKTNVPELMIMPFTESLAFGATRNPWDPNRTPGGSSGGSAAAVAAGLAPVALGSDG 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  239 GGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTavqlSLGPMARDVESLALclkallcehLFTLDPTVPPL--PFRE 316
Cdd:PRK12470 177 GGSIRIPSTWCGLFGLKPQRDRISLEPHDGAWQGLS----VNGPIARSVMDAAL---------LLDATTTVPGPegEFVA 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  317 EVYRSSRPLRVGYyetdNYTMPSPAMRRAlieTKQRLEAaghtlipflpnnipyaleVLSAGGLFSDGGRSFLQnfkgdf 396
Cdd:PRK12470 244 AAAREPGRLRIAL----STRVPTPLPVRC---GKQELAA------------------VHQAGALLRDLGHDVVV------ 292
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  397 VDPCLGDLILILRLPSWFKRLLSLLLKPLFP-RLAAflnsmRPRSAEKL--WKLQHEIEMYRQS---VIAQWKAM--NLD 468
Cdd:PRK12470 293 RDPDYPAATYANYLPRFFRGISDDADAQAHPdRLEA-----RTRAIARLgsFFSDRRMAALRAAevvLSARIQSIfdDVD 367
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  469 VLLTPML--GP----ALD----LNTPGRATGAISYTVLYNCLDFPAGVVPvttvtaeddaqmelykgyfgdiWDIilkka 538
Cdd:PRK12470 368 VVVTPGTatGPsrigAYQrrgaVSTLLLVVQRVPYFQVWNLTGQPAAVVP----------------------WDF----- 420
                        490       500       510
                 ....*....|....*....|....*....|.
gi 13162304  539 mkNSVGLPVAVQCVALPWQEELCLRFMREVE 569
Cdd:PRK12470 421 --DGDGLPMSVQLVGRPYDEATLLALAAQIE 449
PRK07487 PRK07487
amidase; Provisional
88-562 5.52e-23

amidase; Provisional


Pssm-ID: 236029  Cd Length: 469  Bit Score: 100.81  E-value: 5.52e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   88 SGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTD--------CETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLN 159
Cdd:PRK07487  19 SRDVSAREAAEAALARLDAVNPAINAVVDHRPEealaqadaVDAARARGDDPGPLAGVPVTVKVNVDQAGFATTNGVRLQ 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  160 EGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIG 239
Cdd:PRK07487  99 KDLIAPADSPVVDNLRKAGAVIIGRTNTPAFSYRWFTDNPLHGRTLNPWDPSLTPGGSSGGAAAAVAAGIGAIAHGTDIG 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  240 GSIRFPSAFCGICGLKPTGNRL---SKSGLKGCVYGQ-TAVQlslGPMARDVESlalclKALLCEHLFTLDPTVP---PL 312
Cdd:PRK07487 179 GSIRYPAYACGVHGLRPTLGRVpayNASSPERPIGAQlMSVQ---GPLARTVAD-----LRLALAAMAAPDPRDPwwvPA 250
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  313 PFREEVyrssRPLRVGYY-ETDNYTmPSPAMRRALIETKQRLEAAGhtlipflpnnipYALEVLSAGGLFSDGGRSFLQN 391
Cdd:PRK07487 251 PLEGPP----RPKRVALCvRPDGLD-VDPEVEAALRDAARRLEDAG------------WTVEEVDDTPPLREAAELQERL 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  392 FKGDFVDpclGDLILILRLPSwfkrllslllkplfPRLAAFLNSMRPRSAEklWKLQHEIEMY--RQSVIAQWKAMNLD- 468
Cdd:PRK07487 314 WLGDGYE---ALLAAAEAEGD--------------PGALAALRGQRAKARP--LDLAGYMNALarRATLTRQWQLFFEDy 374
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  469 -VLLTPMLG---PALDLNTPG-----RATGAISYTVLYNCLDFPAGVVPVTTVTaeddaqmelykgyfgdiwdiilkkam 539
Cdd:PRK07487 375 pLLLMPVSAelpFPDDLDRQGaegfrRVWEAQLPQIALPFMGLPGLSVPTGLVG-------------------------- 428
                        490       500
                 ....*....|....*....|...
gi 13162304  540 knsvGLPVAVQCVALPWQEELCL 562
Cdd:PRK07487 429 ----GVPVGVQLVAGRFREDLCL 447
amido_AtzE TIGR02715
amidohydrolase, AtzE family; Members of this protein family are aminohydrolases related to, ...
83-570 4.47e-22

amidohydrolase, AtzE family; Members of this protein family are aminohydrolases related to, but distinct from, glutamyl-tRNA(Gln) amidotransferase subunit A. The best characterized member is the biuret hydrolase of Pseudomonas sp. ADP, which hydrolyzes ammonia from the three-nitrogen compound biuret to yield allophanate. Allophanate is also an intermediate in urea degradation by the urea carboxylase/allophanate hydrolase pathway, an alternative to urease [Unknown function, Enzymes of unknown specificity].


Pssm-ID: 233982  Cd Length: 452  Bit Score: 97.93  E-value: 4.47e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304    83 VQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTdcETQLSQAPR----------QGLLYGVPVSLKECFSYKGHDS 152
Cdd:TIGR02715   6 AGAIRSGRVSARAVAEATLARINQADGGLNAFTAVTA--ERALADAARidadlaagspLGPLAGVPFAVKNLFDVAGLTT 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   153 TLGLSLN-EGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSP 231
Cdd:TIGR02715  84 LAGAKINrDLAPAKRDATLVQRLSAAGAVLVGALNMDEFAYGFTTENAHYGPTRNPHDLTRIAGGSSGGSAAAVAAGLVP 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   232 LGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGlkgcVYGQTAVQLSLGPMARDVESLAL-------CLKALLCEHLFT 304
Cdd:TIGR02715 164 FSLGSDTNGSIRVPASLCGVFGLKPTYGRLSRQG----VFPFVASLDHVGPFARSVEDLALaydvmqgPDPQDPFCTDRP 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   305 LDPTVPPLPfreevyRSSRPLRV----GYYEtDNYTmpsPAMRRALIETKQRLEAaghTLIPFLPNN--IPYALEVLSAg 378
Cdd:TIGR02715 240 AEPTVPLLP------AGISGLRIavlgGWFQ-QNAD---PEALAAVGRVAKALGA---TTIVELPDAerARAAAFVITA- 305
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   379 glfSDGGRSFLQNFK---GDFvDPCLGD-LILILRLPSwfkrllslllkplfprlAAFLNSMRPRsaeklwklqheiEMY 454
Cdd:TIGR02715 306 ---SEGGNLHLDALRtrpQDF-DPATRDrLLAGALLPA-----------------SWYAQAQRFR------------HWF 352
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   455 RQSVIAQWKamNLDVLLTPMlgpaldlnTPGRATGAISYTVLYNCLDFPAgvvpvttvtaedDAQMELYKGYFGDIWDII 534
Cdd:TIGR02715 353 RDAIRELFQ--RVDVLIAPA--------TPCSAPLIGQETMIIDGVPVPV------------RANLGIFTQPISFAGLPV 410
                         490       500       510
                  ....*....|....*....|....*....|....*.
gi 13162304   535 LKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQ 570
Cdd:TIGR02715 411 LAAPLPRPGRLPIGVQLIAAPWREDLCLRAAAVLER 446
gatA TIGR00132
aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit; In many species, Gln--tRNA ligase ...
83-363 8.35e-22

aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit; In many species, Gln--tRNA ligase is missing. tRNA(Gln) is misacylated with Glu after which a heterotrimeric amidotransferase converts Glu to Gln. This model represents the amidase chain of that heterotrimer, encoded by the gatA gene. In the Archaea, Asn--tRNA ligase is also missing. This amidase subunit may also function in the conversion of Asp-tRNA(Asn) to Asn-tRNA(Asn), presumably with a different recognition unit to replace gatB. Both Methanococcus jannaschii and Methanobacterium thermoautotrophicum have both authentic gatB and a gatB-related gene, but only one gene like gatA. It has been shown that gatA can be expressed only when gatC is also expressed. In most species expressing the amidotransferase, the gatC ortholog is about 90 residues in length, but in Mycoplasma genitalium and Mycoplasma pneumoniae the gatC equivalent is as the C-terminal domain of a much longer protein. Not surprisingly, the Mycoplasmas also represent the most atypical lineage of gatA orthology. This orthology group is more narrowly defined here than in Proc Natl Acad Aci USA 94, 11819-11826 (1997). In particular, a Rhodococcus homolog found in association with nitrile hydratase genes and described as an enantiomer-selective amidase active on several 2-aryl propionamides, is excluded here. It is likely, however, that the amidase subunit GatA is not exclusively a part of the Glu-tRNA(Gln) amidotransferase heterotrimer and restricted to that function in all species [Protein synthesis, tRNA aminoacylation].


Pssm-ID: 232842  Cd Length: 460  Bit Score: 97.41  E-value: 8.35e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304    83 VQKLQSGELSPEAVFFTYLGKAWEVNKGTNcvtSYLTDC-ETQLSQAPR-----QGLLYGVPVSLKECFSYKGHDSTLGL 156
Cdd:TIGR00132   2 RQLLKKKEISIKEVLEASLDRIEANKDKIN---AFLEVTvEKALKQAKKldkaiLTPLAGIPIAVKDNISTKGIVTTCAS 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   157 SLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGT 236
Cdd:TIGR00132  79 KILENYIPPYDATVIERLKQAGALIIGKTNMDEFAMGSSTETSAFGPTKNPWNLDRVPGGSSGGSAAAVAADLAPFSLGS 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   237 DIGGSIRFPSAFCGICGLKPTGNRLSKSGLkgCVYGQTAVQlsLGPMARDVESlalclKALLCEHLF---TLDPT---VP 310
Cdd:TIGR00132 159 DTGGSIRQPASFCGVVGFKPTYGRVSRYGL--VAYASSLDQ--IGPFARTVED-----IALLLDVISghdKRDSTsakVP 229
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 13162304   311 PLPFREEVYRSSRPLRVGYY-----ETDNytmpspAMRRALIETKQRLEAAGHTLIPF 363
Cdd:TIGR00132 230 DPEFFEELKKDLKGLKVGVVkefseEMDK------EVQEKFENALEVLEELGAEIVEV 281
PRK06169 PRK06169
putative amidase; Provisional
87-401 2.66e-20

putative amidase; Provisional


Pssm-ID: 180437  Cd Length: 466  Bit Score: 92.78  E-value: 2.66e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   87 QSGELSPEAVFFTYLGKAWEVNKGTNCVTsyLTDCETQLSQA-----------PRqGLLYGVPVSLKECFSYKGHDSTLG 155
Cdd:PRK06169  17 RRGELSPVEATQAVLDRIDRRDPAVNAFC--LVDAEGALAAAraseerwrrgePC-GLLDGVPVSIKDIFLTRGWPTLRG 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  156 -LSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGL 234
Cdd:PRK06169  94 sRAIDADGPWDVDAPAVARLREAGAVLLGKTTTPEFGWKGVTDSPLYGITRNPWDTRLTAGGSSGGAAAAVALGMGPLSV 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  235 GTDIGGSIRFPSAFCGICGLKPTGNRL-----SKSGLkgcvygqtavqLS-LGPMARDVESLALCLKALLCEHlfTLDPT 308
Cdd:PRK06169 174 GTDGGGSVRIPASFCGTFGFKPTFGRVplypaSPFGT-----------LAhVGPMTRTVADAALLLDVIARPD--ARDWS 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  309 V---PPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLI---PFLPNNIPyALEVlsaggLFS 382
Cdd:PRK06169 241 AlppPTTSFLDALDRDVRGLRIAYSPTLGYVDVDPEVAALVAQAVQRLAALGARVEevdPGFSDPVE-AFHV-----LWF 314
                        330       340
                 ....*....|....*....|..
gi 13162304  383 DGGRSFLQNF---KGDFVDPCL 401
Cdd:PRK06169 315 AGAARLLRALppgQRALLDPGL 336
PRK07486 PRK07486
amidase; Provisional
84-375 2.05e-17

amidase; Provisional


Pssm-ID: 236028  Cd Length: 484  Bit Score: 83.91  E-value: 2.05e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   84 QKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSyLTDCETQLSQA----------PRQGLLYGVPVSLKECFSYKGHDST 153
Cdd:PRK07486  19 RAIRRRQVSCVEVMRAYLAHIERVNPAVNAIVA-LRDRDALLAEAaekdaalargEYRGWLHGMPQAPKDLAPTKGIRTT 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  154 LGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLG 233
Cdd:PRK07486  98 LGSPIFADQVPQEDAIVVERMRAAGAIFIGKTNTPEFGLGSHTYNPVYGATRNPYDPSRSAGGSSGGAAAALALRMLPVA 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  234 LGTDIGGSIRFPSAFCGICGLKPTGNRLSkSGLKGCVYGQtavQLS-LGPMARDVESLALClkallcehLFTL---DPTV 309
Cdd:PRK07486 178 DGSDMMGSLRNPAAFNNVYGFRPSQGRVP-HGPGGDVFVQ---QLGtEGPMGRTVEDVALL--------LAVQagyDPRD 245
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 13162304  310 P------PLPFREEVYRSSRPLRV-------GYYETDNYTMpsPAMRRALietkQRLEAAGHTLIPFLPnniPYALEVL 375
Cdd:PRK07486 246 PlslaedPARFAQPLEADLRGKRIawlgdwgGYLPMEAGVL--ELCEAAL----ATLRELGCDVEAALP---AFPPERL 315
PRK06170 PRK06170
amidase; Provisional
132-285 5.17e-17

amidase; Provisional


Pssm-ID: 235723  Cd Length: 490  Bit Score: 82.78  E-value: 5.17e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  132 GLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSS 211
Cdd:PRK06170  74 GPLLGIPVTVKESFNVAGLPTTWGFPDLRDYVPAEDAVAVARLKAAGAVILGKTNVPLGLQDWQSYNEIYGTTNNPWDLA 153
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 13162304  212 KSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSL---GPMAR 285
Cdd:PRK06170 154 RTPGGSSGGSAAALAAGFGALSIGSDIGGSLRVPAHYCGVYAHKPTLGLVPLRGHIPPPAPALPGQADLavaGPMAR 230
PRK09201 PRK09201
amidase; Provisional
83-570 7.50e-17

amidase; Provisional


Pssm-ID: 236409  Cd Length: 465  Bit Score: 81.94  E-value: 7.50e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   83 VQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTdcETQLSQAPRQ----------GLLYGVPVSLKECFSYKGHDS 152
Cdd:PRK09201  13 AAAVRAGELSARAVAQATLARIARANPQLNAFTAVTA--ERALAEAARIdaaraageplGPLAGVPFAVKNLFDVAGLTT 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  153 TLGLSLN-EGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSP 231
Cdd:PRK09201  91 LAGSKINrDRPPATRDATAVRRLEAAGAVLVGALNMDEYAYGFTTENSHYGATRNPHDLTRIAGGSSGGSAAAVAAGLVP 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  232 LGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGlkgcVYGQTAVQLSLGPMARDVESLALCLKALLCEHlfTLDPTV-- 309
Cdd:PRK09201 171 FTLGSDTNGSIRVPASLCGIFGLKPTYGRLSRAG----SFPFVASLDHIGPFARSVADLALVYDVLQGPD--PQDPFQad 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  310 -PPLPFREEVYRSSRPLRV----GYYEtdnyTMPSPAMRRALIETKQRLEAAGHTLIP---------FlpnnipyaleVL 375
Cdd:PRK09201 245 rPAEPTAPLLDRGAEGLRIavlgGYFA----QWADPEARAAVDRVAKALGATREVELPeaararaaaF----------II 310
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  376 SAgglfSDGGRSFLQNFK---GDFvDPCLGD-LILILRLPSwfkrllslllkplfprlAAFLNSMRPRSaeklWklqhei 451
Cdd:PRK09201 311 TA----SEGGNLHLPALRtrpQDF-DPASRDrLLAGAMLPA-----------------AWYVQAQRFRR----W------ 358
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  452 emYRQSVIAQWKamNLDVLLTPMlgpaldlnTPGRATGAISYTVLYNCLDFPA----GV---------VPVTTVtaedda 518
Cdd:PRK09201 359 --FRQAVLELFE--HVDVLIAPA--------TPCSAPLIGQETMRIDGVELPVranlGIltqpisfigLPVVAV------ 420
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|..
gi 13162304  519 qmelykgyfgdiwdiilkkAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQ 570
Cdd:PRK09201 421 -------------------PLRTPGGLPIGVQLIAAPWREDLALRAAAALEQ 453
gatA PRK00012
aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed
86-374 9.08e-17

aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed


Pssm-ID: 234572  Cd Length: 459  Bit Score: 81.70  E-value: 9.08e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   86 LQSGELSPEAVFFTYLGKAWEVNKGTNcvtSYLT-DCETQLSQAPR---------QGLLYGVPVSLKECFSYKGHDSTLG 155
Cdd:PRK00012   1 LKNKEISAVELTQAYLDRIEEVDPKLN---AFITvTEEEALAQAKAadaklaageAGPLAGIPIAIKDNICTKGIRTTCA 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  156 LSLNEGMPSESDCVVVQVLKLQGAVPFVHTNvpqsMLSF----DCSNPLFGQTMNPWKSSK----------SPGGSSGGE 221
Cdd:PRK00012  78 SKILENYVPPYDATVVEKLKAAGAVILGKTN----MDEFamgsSTENSAFGPTKNPWDLERvpggssggsaAAVAAGLAP 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  222 GALigsggsplglGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLkgCVYGQtavqlSL---GPMARDVESLALclkall 298
Cdd:PRK00012 154 AAL----------GSDTGGSIRQPAAFCGVVGLKPTYGRVSRYGL--IAFAS-----SLdqiGPFARTVEDAAL------ 210
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  299 cehLF------------TLDPTVPplPFREEVYRSSRPLRVGY---YETDNYtmpSPAMRRALIETKQRLEAAGHTLIPF 363
Cdd:PRK00012 211 ---LLnaiaghdpkdstSADVPVP--DYTAALGKDIKGLKIGVpkeYFGEGL---DPEVKEAVEAAIKKLEDLGAEIVEV 282
                        330
                 ....*....|..
gi 13162304  364 -LPnNIPYALEV 374
Cdd:PRK00012 283 sLP-HTKYALPA 293
PRK07056 PRK07056
amidase; Provisional
134-287 2.74e-16

amidase; Provisional


Pssm-ID: 235921  Cd Length: 454  Bit Score: 80.37  E-value: 2.74e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  134 LYGVPVSLKECFSYKGHDSTLG-LSLNEGMPSESDCVVVQVLKLQGAVPFVHTNvpqsMLSFDCS----NPLFGQTMNPW 208
Cdd:PRK07056  72 LAGIPVSVKDLFDVAGQVTRAGsRVLADAPPAAADAPAVARLRRAGAVLIGRTN----MTEFAFSglglNPHYGTPRNPW 147
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  209 KSSKSPG--------------GSSGGEGALigsggsplglGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGlkgcvygqt 274
Cdd:PRK07056 148 RRDVGDGripggsssgaavsvADGMAAAAL----------GTDTGGSIRIPAALCGLTGFKPTARRVPLQG--------- 208
                        170
                 ....*....|....*...
gi 13162304  275 AVQLS-----LGPMARDV 287
Cdd:PRK07056 209 AVPLSttldsIGPLARSV 226
PRK07488 PRK07488
indole acetimide hydrolase; Validated
83-362 1.54e-15

indole acetimide hydrolase; Validated


Pssm-ID: 236030  Cd Length: 472  Bit Score: 78.09  E-value: 1.54e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   83 VQKLQSGELSPEAVFFTYLGKAwEVNKGTNCVTSylTDCETQLSQA------PRQG---LLYGVPVSLKECFSYKGHDST 153
Cdd:PRK07488  17 AAALRSGRLSCLELVEALLARA-AALAPLNAFTT--VDAEGALAAArridaqRAAGaalLLAGVPIVIKDNINTAGMPTT 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  154 LG-LSLNEGMPSeSDCVVVQVLKLQGAVPFVHTNVPQsmLSFDCS--NPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGS 230
Cdd:PRK07488  94 AGtPALLGFVPA-TDAPVVQRLLDAGAVPLGKANMHE--LAFGITsnNGAFGAVRNPYDPARIAGGSSGGTAAAVAARLA 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  231 PLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLkgcvygqtaVQLS-----LGPMARDVESlalclkALLCEHLFTL 305
Cdd:PRK07488 171 PAGLGTDTGGSVRIPAALCGVVGLRPTVGRYSGDGV---------VPIShtrdtVGPIARSVAD------LALLDAVITG 235
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 13162304  306 DPTVPPLPfreevyrSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIP 362
Cdd:PRK07488 236 DAALPAPV-------ALAGLRLGVPAAPFWDGLDPDVAAVAEAALAKLAAAGVTFVE 285
PRK06529 PRK06529
amidase; Provisional
83-373 4.62e-14

amidase; Provisional


Pssm-ID: 180608  Cd Length: 482  Bit Score: 73.32  E-value: 4.62e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   83 VQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSylTDCETQLSQAPRQ---GLLY-GVPVSLKECF-SYKGHDSTLGLS 157
Cdd:PRK06529  10 AQAVQQGQVTPLELVTQAIYKAKKLNPTLNAIVS--ERYEEALEEAKQRdfsGKPFaGVPIFLKDLGqELKGQLSTSGSR 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  158 LNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTD 237
Cdd:PRK06529  88 LFKNYQATKTDLYVKRLEDLGFIILGRSNTPEFGFKNISDSSLHGPVNLPFDNSRNAGGSSGGAAALVSSGIVALAAASD 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  238 IGGSIRFPSAFCGICGLKPTGNRL-----SKSGLKGcvygqTAVQLSLGPMARDVESLALCLKALLCEHLFTLdptvPPL 312
Cdd:PRK06529 168 GGGSIRIPASFNGLIGLKPSRGRIpvgpgSYRGWQG-----ASVHFALTKSVRDTRRLLYYLQMYQMESPFPL----ATL 238
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 13162304  313 PfREEVYRS-SRPLRVGYYETDNYTMP-SPAMRRALIETKQRLEAAGHTLIPF--LPNNIPYALE 373
Cdd:PRK06529 239 S-KESLFQSlQRPLKIAFYQRSPDGSPvSLDAAKALKQAVTFLREQGHEVVELeeFPLDMTEVMR 302
PRK06061 PRK06061
amidase; Provisional
134-374 1.14e-12

amidase; Provisional


Pssm-ID: 235686  Cd Length: 483  Bit Score: 68.96  E-value: 1.14e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  134 LYGVPVSLKECFSYKGHDSTLGLSlNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKS 213
Cdd:PRK06061  82 LLGVPIAVKDDVDVAGVPTAFGTA-GEVPPATADSEVVRRLRAAGAVIVGKTNTCELGQWPFTSGPAFGHTRNPWSRDHT 160
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  214 PGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAvqlsLGPMARDVESLALC 293
Cdd:PRK06061 161 PGGSSGGSAAAVAAGLVTAAIGSDGAGSVRIPAAWTHLVGIKPQRGRISTWPLPEAFNGLTV----NGPLARTVADAALL 236
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  294 LKALLCEHLFTLDpTVPPLPFREEVYRSSRPLRVGYYETDNYT-MPS---PAMRRALIETKQRLEAAGHTLIPFLPnniP 369
Cdd:PRK06061 237 LDAASGNHPGDRH-RPPPVTVSDAVGRAPGPLRIALSTRFPFTgFPAklhPEIRAAVRRVAEQLALLGHTVVPADP---D 312

                 ....*
gi 13162304  370 YALEV 374
Cdd:PRK06061 313 YGLRL 317
PRK07042 PRK07042
amidase; Provisional
132-365 1.47e-12

amidase; Provisional


Pssm-ID: 235915  Cd Length: 464  Bit Score: 68.46  E-value: 1.47e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  132 GLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQ-SMLSFDCSNpLFGQTMNPWKS 210
Cdd:PRK07042  70 GPLDGVPVTIKENIATRGVPVPLGTAATDLPPAAADAPPAARLREAGAVILAKTTMPDyGMLSSGLSS-FHGLTRNPWDL 148
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  211 SKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSksgLKGCVYGQTAvqlslGPMARDVESL 290
Cdd:PRK07042 149 DQNPGGSSAGAGAAAAAGYGPLHLGTDIGGSVRLPAGWCGIVGLKPSLGRIP---IDPPYTGRCA-----GPMTRTVDDA 220
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  291 ALClkallcehLFTL------DPT-VPPLPFR-EEVYRSSRPLRVGYYETDNYTMP-SPAMRRALIETKQRLEAAGHTLI 361
Cdd:PRK07042 221 ALL--------MSVLsrpdarDGTsLPPQDIDwSDLDIDVRGLRIGLMLDAGCGLAvDPEVRAAVEAAARRFEAAGAIVE 292

                 ....
gi 13162304  362 PFLP 365
Cdd:PRK07042 293 PVPP 296
PRK06102 PRK06102
hypothetical protein; Provisional
84-357 6.03e-11

hypothetical protein; Provisional


Pssm-ID: 235698  Cd Length: 452  Bit Score: 63.51  E-value: 6.03e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   84 QKLQSGELSPEAVFFTYLGKAwEVNKGTNCVTSYLTD---CETQLSQAP-RQG----LLYGVPVSLKECFSYKGHDSTLG 155
Cdd:PRK06102  13 VLIQSGALDPVQVAEQALDAI-ASYADQAVFISLTEEramREAEASSARwRAGrslgLLDGIPIAWKDLFDVAGSVTTAG 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  156 LS-LNEGMPSESDCVVVQVLKLQGAVPFVHTNvpqsMLSFDCS----NPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGS 230
Cdd:PRK06102  92 SVvLANAAPASRDAAVVALLARAGMVSIGRTN----MSEFAFSglglNPHYGTPVNPRSTDVPRIPGGSSSGSAVAVAAG 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  231 PL--GLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGlkgcVYGQTAVQLSLGPMARDVESLALclkallcehlftLDPT 308
Cdd:PRK06102 168 LVpvAMGTDTGGSVRIPAAFNGLVGYKATRGRYSMDG----VFPLAKSLDSLGPLCRSVRDAVW------------IDAA 231
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*....
gi 13162304  309 VPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAG 357
Cdd:PRK06102 232 MRGLTAPDVVRRPLAGLRLVVPETVVFDDAEPGVRAAFEAAVERLQAAG 280
PRK08137 PRK08137
amidase; Provisional
132-578 3.22e-09

amidase; Provisional


Pssm-ID: 236161  Cd Length: 497  Bit Score: 57.86  E-value: 3.22e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  132 GLLYGVPVSLKECF-SYKGHDSTLG-LSLNEGMPSEsDCVVVQVLKLQGAVPFVHTNVPQ-----SMLSFDCSNPLFGQT 204
Cdd:PRK08137  71 GPLHGIPVLLKDNIdAADPMPTTAGsLALAGNRPTR-DAFLVARLRDAGAVILGKANLSEwanfrSTRSSSGWSARGGLT 149
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  205 MNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQ-TAvqlslGPM 283
Cdd:PRK08137 150 RNPYALDRSPCGSSSGSGAAVAAGLAAVAIGTETDGSITCPAAINGLVGLKPTVGLVSRDGIVPISHSQdTA-----GPM 224
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  284 ARDVESLALCLKALLCEHlfTLDPTVPPLPFREEVYRSS------RPLRVGYYEtdNYTMPSPAMRRALIETKQRLEAAG 357
Cdd:PRK08137 225 TRTVADAAAVLTAIAGGD--PADPATASAPAPAVDYVAAldadalRGARLGVAR--NYLGYHPEVDAQFERALAELKAAG 300
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  358 HTLIPflpnnipyaLEVLSAGGLFSDGGRSFLQNFKGDfvdpclgdlililrLPSWFKRLLSLLLKPLFPRLAAFLNSMR 437
Cdd:PRK08137 301 AVVID---------VVDLDDGDWGEAEKVVLLHEFKAG--------------LNAYLRSTAPHAPVRTLADLIAFNRAQH 357
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  438 PRSAEklWKLQHEIEM-----------YR------------QSVIAQWKAMNLDVLLTPMLGPA--LDL----NTPGRAT 488
Cdd:PRK08137 358 AREMP--YFGQELFEQaqaapglddpaYLdaladakrlagpEGIDAALKEHRLDALVAPTTGPAwlIDLingdSFGGSSS 435
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  489 GAISYTvlynclDFPAGVVPVTTVTaeddaqmelykgyfgdiwdiilkkamknsvGLPVAVQCVALPWQEELCLRFMREV 568
Cdd:PRK08137 436 TPAAVA------GYPHLTVPMGQVQ------------------------------GLPVGLSFIGAAWSEARLLELGYAY 479
                        490
                 ....*....|
gi 13162304  569 EQLMTPQKQP 578
Cdd:PRK08137 480 EQATHARREP 489
PRK07869 PRK07869
amidase; Provisional
83-261 1.44e-08

amidase; Provisional


Pssm-ID: 181154  Cd Length: 468  Bit Score: 55.76  E-value: 1.44e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   83 VQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTsyLTDCETQLSQAPR----QGLLYGVPVSLKECFSYKGHDSTLGLSL 158
Cdd:PRK07869  21 AEAIRAGRVSAAEVVEAAIARAEAVNPALNALA--YAAFDRARDRAARpgsqGGFFSGVPTFIKDNVDVAGLPTMHGSDA 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  159 NEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDI 238
Cdd:PRK07869  99 WTPRPAKADSDFARQFLATGLISLGKTQLPEFGFSASTEHPRLGPVRNPWNTDYSAGASSGGSAALVAAGVVPIAHANDG 178
                        170       180
                 ....*....|....*....|...
gi 13162304  239 GGSIRFPSAFCGICGLKPTGNRL 261
Cdd:PRK07869 179 GGSIRIPAACCGLVGLKPSRGRL 201
PRK08310 PRK08310
amidase; Provisional
236-356 3.24e-08

amidase; Provisional


Pssm-ID: 181375  Cd Length: 395  Bit Score: 54.60  E-value: 3.24e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  236 TDIGGSIRFPSAFCGICGLKPTGNRLSksgLKGCvygqtavqLSLGP-------MARDVEslalcLKALLCEHLFTLDPT 308
Cdd:PRK08310 130 TDTGGSVRAPASFCGLYGLRPTHGRIS---LEGV--------MPLAPsfdtvgwFARDIA-----LLERVGEVLLGDDAQ 193
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 13162304  309 VPPLPFREevyrssrplrvgYYETDNYTMPSPAMRRALIETKQRLEAA 356
Cdd:PRK08310 194 EFPLTQRL------------LIPVDLFALLDPAVRAALEAALARLRPH 229
PRK06828 PRK06828
amidase; Provisional
131-288 6.60e-08

amidase; Provisional


Pssm-ID: 180715  Cd Length: 491  Bit Score: 53.67  E-value: 6.60e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  131 QGLLYGVPVSLKECF--SYKGHDSTLGLSLNEGMPSEsDCVVVQVLKLQGAVPFVHTNVPQ--SMLSFDCSNPLF---GQ 203
Cdd:PRK06828  77 RGPLHGIPVLLKDNIetNDSMHTSAGTIALEQHISSE-DAFLVTKLREAGAVILGKANMTElaNFMSFEMWAGYSargGQ 155
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  204 TMNPW---KSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQ-TAvqls 279
Cdd:PRK06828 156 TINPYgtgEDDMFVGGSSTGSAIAVAANFTVVSVGTETDGSILSPAVQNSVVGIKPTVGLISRRGIIPFTYSQdTA---- 231

                 ....*....
gi 13162304  280 lGPMARDVE 288
Cdd:PRK06828 232 -GPFARTVT 239
PRK05962 PRK05962
amidase; Validated
132-357 4.57e-07

amidase; Validated


Pssm-ID: 168315  Cd Length: 424  Bit Score: 50.93  E-value: 4.57e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  132 GLLYGVPVSLKECFSYKGHDSTLG-LSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKS 210
Cdd:PRK05962  44 GPLDGRIVSIKDLFDVAGEPTLAGsVIRRDAPPAGADALIVQRLRNAGAVIIGKTHMTEFAFTPVGLNPHYGEPGNAIDP 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  211 SKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGlkgcvygqtAVQL-----SLGPMAR 285
Cdd:PRK05962 124 ARIPGGSSSGAAVSVAEGTSEIAIGSDTGGSVRIPAALNGLVGFKPTARRIPLEG---------AFPLspsldSIGPLAR 194
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 13162304  286 DVESLALCLKALLCEHLFTLDPtvPPLpfreevyrssRPLRV----GYYETDNYTMPSPAMRRALietkQRLEAAG 357
Cdd:PRK05962 195 TVADCAAADAVMAGEKPIPLEV--LPV----------AGLRIglpkGYLLADMEPDVAAAFEASL----AALEKAG 254
PRK07235 PRK07235
amidase; Provisional
237-288 2.65e-06

amidase; Provisional


Pssm-ID: 235979  Cd Length: 502  Bit Score: 48.85  E-value: 2.65e-06
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 13162304  237 DIGGSIRFPSAFCGICGLKPTgnrlsksglKGCV-Y-GQTAVQLS---LGPMARDVE 288
Cdd:PRK07235 191 DQGGSIRIPSAWCGIYGMKPT---------HGLVpYtGAFPIERTidhLGPMTATVR 238
allophanate_hyd TIGR02713
allophanate hydrolase; Allophanate hydrolase catalyzes the second reaction in an ATP-dependent ...
128-365 2.25e-04

allophanate hydrolase; Allophanate hydrolase catalyzes the second reaction in an ATP-dependent two-step degradation of urea to ammonia and C02, following the action of the biotin-containing urea carboxylase. The yeast enzyme, a fusion of allophanate hydrolase to urea carboxylase, is designated urea amidolyase [Central intermediary metabolism, Nitrogen metabolism].


Pssm-ID: 233981  Cd Length: 561  Bit Score: 42.71  E-value: 2.25e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   128 APRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPsESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNP 207
Cdd:TIGR02713  26 RPERLPLYGVPFAVKDNIDVAGLPTTAACPAFAYTP-EEDATVVALLRAAGAIVVGKTNLDQFATGLVGTRSPYGAVRNA 104
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   208 WKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGL------KGCVY--------GQ 273
Cdd:TIGR02713 105 FDPAYISGGSSSGSAVAVARGLVPFALGTDTAGSGRVPAALNNIVGLKPTKGLVSTTGVvpacrsLDCVSifaltvadAE 184
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   274 TAVQLSLGPMARDVESLalclkallcehlftldPTVPPLPFreevyRSSRPLRVGyyetdnytMPSPAMR---------R 344
Cdd:TIGR02713 185 QVLRIAAAPDARDPYSR----------------PLPAAALR-----RFPPPPRVG--------VPRAAQLeffgdsqaeA 235
                         250       260
                  ....*....|....*....|...
gi 13162304   345 ALIETKQRLEAAGHTL--IPFLP 365
Cdd:TIGR02713 236 AFAAAVERLEALGVEVveIDFAP 258
PRK06707 PRK06707
amidase; Provisional
40-287 7.03e-04

amidase; Provisional


Pssm-ID: 235855  Cd Length: 536  Bit Score: 41.05  E-value: 7.03e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304   40 AATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSyLT 119
Cdd:PRK06707  34 EPERIVYDKERVLQPIHNQLKGINIENVKIKEKEVVNATVDELQKMIDDGKLSYEELTSIYLFRIQEHDQNGITLNS-VT 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  120 DCETQ-------LSQAPRQGL---LYGVPVSLKECF-SYKGHDSTLG-LSLNEGMPSEsDCVVVQVLKLQGAVPFVHTNV 187
Cdd:PRK06707 113 EINPNameearkLDQERSRNKksnLYGIPVVVKDNVqTAKVMPTSAGtYVLKDWIADQ-DATIVKQLKEEGAFVLGKANM 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13162304  188 PQ--SMLSFDCSNPL---FGQTMNPWKSSKSPGG-SSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRL 261
Cdd:PRK06707 192 SEwaNYLSFTMPSGYsgkKGQNLNPYGPIKFDTSgSSSGSATVVAADFAPLAVGTETTGSIVAPAAQQSVVGLRPSLGMV 271
                        250       260       270
                 ....*....|....*....|....*....|.
gi 13162304  262 SKSGLkgcvygqtaVQLS-----LGPMARDV 287
Cdd:PRK06707 272 SRTGI---------IPLAetldtAGPMARTV 293
PLN02722 PLN02722
indole-3-acetamide amidohydrolase
236-266 1.34e-03

indole-3-acetamide amidohydrolase


Pssm-ID: 166363  Cd Length: 422  Bit Score: 39.87  E-value: 1.34e-03
                         10        20        30
                 ....*....|....*....|....*....|.
gi 13162304  236 TDIGGSIRFPSAFCGICGLKPTGNRLSKSGL 266
Cdd:PLN02722 131 TDTGGSVRVPASYCGIFGFRPSHGAVSTVGV 161
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH