NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|13027636|ref|NP_001391|]
View 

sphingosine 1-phosphate receptor 1 [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
68-311 1.46e-44

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


:

Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 155.92  E-value: 1.46e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636    68 LTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGAT-TYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITM 146
Cdd:pfam00001   1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGgDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636   147 LKMKLHNGSNNFRL-FLLISACWVISLILGGLPIMGWNCI----SALSSCSTVLPLYHK---HYILFCTTVFTLLLLSIV 218
Cdd:pfam00001  81 VHPLRYRRIRTPRRaKVLILVVWVLALLLSLPPLLFSWLRtveeGNVTTCLIDFPEESTlrsYTLLSTLLGFVLPLLVIL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636   219 ILYCRIYSLVRTRSRRLTFrknISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEY-FL 297
Cdd:pfam00001 161 VCYTLILRTLRKRARSGAS---QARAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSIIRLLPTALLiTL 237
                         250
                  ....*....|....
gi 13027636   298 VLAVLNSGTNPIIY 311
Cdd:pfam00001 238 WLAYVNSCLNPIIY 251
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
68-311 1.46e-44

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 155.92  E-value: 1.46e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636    68 LTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGAT-TYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITM 146
Cdd:pfam00001   1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGgDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636   147 LKMKLHNGSNNFRL-FLLISACWVISLILGGLPIMGWNCI----SALSSCSTVLPLYHK---HYILFCTTVFTLLLLSIV 218
Cdd:pfam00001  81 VHPLRYRRIRTPRRaKVLILVVWVLALLLSLPPLLFSWLRtveeGNVTTCLIDFPEESTlrsYTLLSTLLGFVLPLLVIL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636   219 ILYCRIYSLVRTRSRRLTFrknISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEY-FL 297
Cdd:pfam00001 161 VCYTLILRTLRKRARSGAS---QARAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSIIRLLPTALLiTL 237
                         250
                  ....*....|....
gi 13027636   298 VLAVLNSGTNPIIY 311
Cdd:pfam00001 238 WLAYVNSCLNPIIY 251
PHA02834 PHA02834
chemokine receptor-like protein; Provisional
50-322 2.50e-07

chemokine receptor-like protein; Provisional


Pssm-ID: 165177 [Multi-domain]  Cd Length: 323  Bit Score: 50.67  E-value: 2.50e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636   50 VVFILICCFIILENIFVLlTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTAnLLLSGATTYKLTPAQWFLREGSMFVALS 129
Cdd:PHA02834  33 VFYILLFIFGLIGNVLVI-AVLIVKRFMFVVDVYLFNIAMSDLMLVFSFPF-IIHNDLNEWIFGEFMCKLVLGVYFVGFF 110
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636  130 ASVFSLLAIAIERYITMLK-MKLHNGSNNFRLFLLISAcWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYIL---- 204
Cdd:PHA02834 111 SNMFFVTLISIDRYILVVNaTKIKNKSISLSVLLSVAA-WVCSVILSMPAMVLYYVDNTDNLKQCIFNDYHENFSWsaff 189
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636  205 -FCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKniskasrsseKSLALLKTVIIVLSVFiacWAPLFILL------- 276
Cdd:PHA02834 190 nFEINIFGIVIPLIILIYCYSKILYTLKNCKNKNKT----------RSIKIILTVVTFTVVF---WVPFNIVLfinslqs 256
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 13027636  277 --LLDVGCkVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAF 322
Cdd:PHA02834 257 vgLIDIGC-YHFKKIVYSIDIAELISFVHCCVNPIIYAFVGKNFKKVF 303
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
68-311 1.46e-44

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 155.92  E-value: 1.46e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636    68 LTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGAT-TYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITM 146
Cdd:pfam00001   1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGgDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636   147 LKMKLHNGSNNFRL-FLLISACWVISLILGGLPIMGWNCI----SALSSCSTVLPLYHK---HYILFCTTVFTLLLLSIV 218
Cdd:pfam00001  81 VHPLRYRRIRTPRRaKVLILVVWVLALLLSLPPLLFSWLRtveeGNVTTCLIDFPEESTlrsYTLLSTLLGFVLPLLVIL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636   219 ILYCRIYSLVRTRSRRLTFrknISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEY-FL 297
Cdd:pfam00001 161 VCYTLILRTLRKRARSGAS---QARAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSIIRLLPTALLiTL 237
                         250
                  ....*....|....
gi 13027636   298 VLAVLNSGTNPIIY 311
Cdd:pfam00001 238 WLAYVNSCLNPIIY 251
PHA02834 PHA02834
chemokine receptor-like protein; Provisional
50-322 2.50e-07

chemokine receptor-like protein; Provisional


Pssm-ID: 165177 [Multi-domain]  Cd Length: 323  Bit Score: 50.67  E-value: 2.50e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636   50 VVFILICCFIILENIFVLlTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTAnLLLSGATTYKLTPAQWFLREGSMFVALS 129
Cdd:PHA02834  33 VFYILLFIFGLIGNVLVI-AVLIVKRFMFVVDVYLFNIAMSDLMLVFSFPF-IIHNDLNEWIFGEFMCKLVLGVYFVGFF 110
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636  130 ASVFSLLAIAIERYITMLK-MKLHNGSNNFRLFLLISAcWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYIL---- 204
Cdd:PHA02834 111 SNMFFVTLISIDRYILVVNaTKIKNKSISLSVLLSVAA-WVCSVILSMPAMVLYYVDNTDNLKQCIFNDYHENFSWsaff 189
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636  205 -FCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKniskasrsseKSLALLKTVIIVLSVFiacWAPLFILL------- 276
Cdd:PHA02834 190 nFEINIFGIVIPLIILIYCYSKILYTLKNCKNKNKT----------RSIKIILTVVTFTVVF---WVPFNIVLfinslqs 256
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 13027636  277 --LLDVGCkVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAF 322
Cdd:PHA02834 257 vgLIDIGC-YHFKKIVYSIDIAELISFVHCCVNPIIYAFVGKNFKKVF 303
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
14-327 1.55e-06

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 48.24  E-value: 1.55e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636   14 SSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKkFHRPMYYFIGNLALSDLL 93
Cdd:PHA03087   9 TTIENTTDYYYDTYYDEDYADCDLNIGYDTNSTILIVVYSTIFFFGLVGNIIVIYVLTKTK-IKTPMDIYLLNLAVSDLL 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636   94 AGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISAC-WVISL 172
Cdd:PHA03087  88 FVMTLPFQIYYYILFQWSFGEFACKIVSGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLViWIISI 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636  173 ILGgLPIMGWNCISALSSCSTVLPLYH------KHYILFCTTVFTLLLLSIVILYCRIYSLvrtrsrrltfrkNISKASR 246
Cdd:PHA03087 168 IET-TPILFVYTTKKDHETLICCMFYNnktmnwKLFINFEINIIGMLIPLTILLYCYSKIL------------ITLKGIN 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13027636  247 SSEKSLALLKTVIIVLSVFIACWAP----LFILLLLDVGCKvKTCDILFRAEYFL----VLAVLNSGTNPIIYTLTNKEM 318
Cdd:PHA03087 235 KSKKNKKAIKLVLIIVILFVIFWLPfnvsVFVYSLHILHFK-SGCKAVKYIQYALhvteIISLSHCCINPLIYAFVSEFF 313
                        330
                 ....*....|..
gi 13027636  319 ---RRAFIRIMS 327
Cdd:PHA03087 314 nkhKKKSLKLMF 325
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH