NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|125973153|ref|YP_001037063|]
View 

protein serine/threonine phosphatases [Ruminiclostridium thermocellum ATCC 27405]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
13-271 6.01e-43

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 148.63  E-value: 6.01e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  13 AATHIGYVRSANEDNFYlngiffspsmtektILFDINEADsFFLFAVSDGLGGEIRGDEASLTAMRELKKAHNLIKNNNN 92
Cdd:cd00143    4 GVSDKGGDRKTNEDAVV--------------IKPNLNNED-GGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSE 68
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  93 GNINSCavnINSYIKNTNNLIYNM--SVQYGARMGTTFAALLICGDRAQTFNLGDSRIYHVTDGEIVQLTKDHT-----E 165
Cdd:cd00143   69 EDIEEA---LRKAFLRADEEILEEaqDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKpvneeE 145
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153 166 AERLVRLGILSPEEASKsaSKNMLYKFLG-IPPKEGII-EADISESFFVKKGDVFLLCTDGLTNMVENERIKDVIN---T 240
Cdd:cd00143  146 RERIEKAGGRVSNGRVP--GVLAVTRALGdFDLKPGVSaEPDVTVVKLTEDDDFLILASDGLWDVLSNQEAVDIVRselA 223
                        250       260       270
                 ....*....|....*....|....*....|.
gi 125973153 241 ENTPSKAASKLINEALENGGFDNITCIVVKI 271
Cdd:cd00143  224 KEDLQEAAQELVDLALRRGSHDNITVVVVRL 254
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
13-271 6.01e-43

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 148.63  E-value: 6.01e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  13 AATHIGYVRSANEDNFYlngiffspsmtektILFDINEADsFFLFAVSDGLGGEIRGDEASLTAMRELKKAHNLIKNNNN 92
Cdd:cd00143    4 GVSDKGGDRKTNEDAVV--------------IKPNLNNED-GGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSE 68
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  93 GNINSCavnINSYIKNTNNLIYNM--SVQYGARMGTTFAALLICGDRAQTFNLGDSRIYHVTDGEIVQLTKDHT-----E 165
Cdd:cd00143   69 EDIEEA---LRKAFLRADEEILEEaqDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKpvneeE 145
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153 166 AERLVRLGILSPEEASKsaSKNMLYKFLG-IPPKEGII-EADISESFFVKKGDVFLLCTDGLTNMVENERIKDVIN---T 240
Cdd:cd00143  146 RERIEKAGGRVSNGRVP--GVLAVTRALGdFDLKPGVSaEPDVTVVKLTEDDDFLILASDGLWDVLSNQEAVDIVRselA 223
                        250       260       270
                 ....*....|....*....|....*....|.
gi 125973153 241 ENTPSKAASKLINEALENGGFDNITCIVVKI 271
Cdd:cd00143  224 KEDLQEAAQELVDLALRRGSHDNITVVVVRL 254
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
2-272 3.63e-55

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 181.01  E-value: 3.63e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153   2 YSEKNIILRATAATHIGYVRSANEDNFYlngiffspsmtektILFDINEaDSFFLFAVSDGLGGEIRGDEAS---LTAMR 78
Cdd:COG0631    1 SSSGILSLKVAGLSDVGTVRKHNEDAFL--------------IKPNENG-NLLLLFAVADGMGGHAAGEVASklaVEALA 65
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  79 ELKKAHNLIKNNNNGNINscavnINSYIKNTNNLIY---NMSVQYgARMGTTFAALLICGDRAQTFNLGDSRIYHVTDGE 155
Cdd:COG0631   66 RLFDETNFNSLNESLEEL-----LKEAILKANEAIAeegQLNEDV-RGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGE 139
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153 156 IVQLTKDHTEAERLVRLGILSPEEASKSASKNMLYKFLGIPPKegiIEADIsESFFVKKGDVFLLCTDGLTNMVENERIK 235
Cdd:COG0631  140 LKQLTEDHSLVNRLEQRGIITPEEARSHPRRNALTRALGDFDL---LEPDI-TELELEPGDFLLLCSDGLWDVVSDDEIV 215
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 125973153 236 DVINTENTPSKAASKLINEALENGGFDNITCIVVKIE 272
Cdd:COG0631  216 DILKNSETPQEAADKLIELALEGGGPDNITVVLVRLN 252
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
2-269 4.18e-33

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 122.48  E-value: 4.18e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153     2 YSEKNIILRaTAATHIGYVRSANEDNFYLNGIFFspsmtektilfdineaDSFFLFAVSDGLGGeirgDEASLTAMRELK 81
Cdd:smart00332   2 VSGKNLGLR-YGLSSMQGVRKPMEDAHVITPDLS----------------DSGGFFGVFDGHGG----SEAAKFLSKNLP 60
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153    82 KAhnliKNNNNGNINSCAVNINSYIKNTNNLI-YNMSVQYGARMGTTFAALLICGDRAQTFNLGDSRIYHVTDGEIVQLT 160
Cdd:smart00332  61 EI----LAEELIKEKDELEDVEEALRKAFLSTdEEILEELEALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLT 136
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153   161 KDHT-----EAERLVRLGilspEEASKSASKNMLY---KFLGIPPKEGII-EADISESFFVKKGDVFLLCTDGLTNMVEN 231
Cdd:smart00332 137 EDHKpsnedERARIEAAG----GFVINGRVNGVLAlsrAIGDFFLKPYVSaEPDVTVVELTEKDDFLILASDGLWDVLSN 212
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|
gi 125973153   232 ERIKDVI--NTENTPSKAASKLINEALENGGFDNITCIVV 269
Cdd:smart00332 213 QEVVDIVrkHLSKDPKEAAKRLIDLALARGSKDNITVVVV 252
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
14-264 7.10e-17

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 76.63  E-value: 7.10e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153   14 ATHIGYVRSANEDNFYLNGIFFSPSmtektilfdinEADSFFLFAVSDGLGGEIRGDEASLTAMRELKKAhnlikNNNNG 93
Cdd:pfam00481   5 GTRMQGWRKSMEDAHIDGKNLNSSS-----------GKDSWSFFAVFDGHGGSEAAKYAGKHLHTILALR-----RSFLT 68
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153   94 NINSCAVNINSYIkNTNNLIYNMSVQYG-ARMGTTFAALLICGDRAQTFNLGDSRIYHVTDGE-IVQLTKDHT-----EA 166
Cdd:pfam00481  69 LRKLEDALRESFL-ETDEELRSDAANHEdLSSGSTAVVALIRGNKLYVANVGDSRAVLCRNGGaIKQLTEDHKpsdedER 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  167 ERLVRLG--------ILSPEEASKSAS-KNMLYKFLGIPPKEGIIEADISESffvkkgDVFL-LCTDGLTNMVENERIKD 236
Cdd:pfam00481 148 RRIRAAGgfvsrngrVNGVLAVSRAFGdFDLKPGEQPVSAEPDITSHKITED------DEFLiLACDGLWDVLSDQEVVD 221
                         250       260       270
                  ....*....|....*....|....*....|..
gi 125973153  237 VINTE----NTPSKAASKLINEALENGGFDNI 264
Cdd:pfam00481 222 IVRSNlsdgGDPMEAAEKLVDEAIAYGSEDNI 253
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
9-271 2.52e-19

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 86.65  E-value: 2.52e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153   9 LRATAATHIGYVRSANEDNFYLNgiffspSMTEKTILFDINEADSFFLFAVSDGLGGEIRGDEASLTAMRELK---KAHN 85
Cdd:PRK14559 375 LEDAGRTDVGRQRHHNEDYFGIN------TRIQKLENPHGRIVQARGLYILCDGMGGHAAGEVASALAVETLQqyfQQHW 448
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  86 LIKNNNngninscAVNINSYIKNTNNLIYNMSVQ---YGA-RMGTTFAALLICGDRAQTFNLGDSRIYHVT-DGEIVQLT 160
Cdd:PRK14559 449 QDELPD-------EETIREAIYLANEAIYDLNQQnarSGSgRMGTTLVMALVQDTQVAVAHVGDSRLYRVTrKGGLEQLT 521
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153 161 KDHTEAERLVRLGiLSPEEASKSASKNMLYKFLGiPPKEGIIEADIsESFFVKKGDVFLLCTDGLTN--MVEN---ERIK 235
Cdd:PRK14559 522 VDHEVGQREIQRG-VEPQIAYARPDAYQLTQALG-PRDNSAIQPDI-QFLEIEEDTLLLLCSDGLSDndLLEThwqTHLL 598
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 125973153 236 DVINTENTPSKAASKLINEALENGGFDNITCIVVKI 271
Cdd:PRK14559 599 PLLSSSANLDQGLNKLIDLANQYNGHDNITAILVRL 634
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
121-273 4.93e-06

protein phosphatase 2C; Provisional


Pssm-ID: 240318 [Multi-domain]  Cd Length: 381  Bit Score: 45.92  E-value: 4.93e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153 121 GARMGTTFAA-----LLICgdraqtfNLGDSRIYHVTDGEIVQLTKDHT-----EAERLV---------RL-GILSPEEA 180
Cdd:PTZ00224 104 GGSTGTFCVImkdvhLQVG-------NVGDSRVLVCRDGKLVFATEDHKpnnpgERQRIEacggrvvsnRVdGDLAVSRA 176
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153 181 -------SKSASKNMLYKFLGIPpkegiieaDISESFFvKKGDVFLLCTDGL-TNMVENERIKDVIN--TENTPSKA--A 248
Cdd:PTZ00224 177 fgdrsfkVKGTGDYLEQKVIAVP--------DVTHLTC-QSNDFIILACDGVfEGNFSNEEVVAFVKeqLETCDDLAvvA 247
                        170       180
                 ....*....|....*....|....*
gi 125973153 249 SKLINEALENGGFDNITCIVVKIED 273
Cdd:PTZ00224 248 GRVCDEAIRRGSKDNISCLIVQLKD 272
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
13-271 6.01e-43

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 148.63  E-value: 6.01e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  13 AATHIGYVRSANEDNFYlngiffspsmtektILFDINEADsFFLFAVSDGLGGEIRGDEASLTAMRELKKAHNLIKNNNN 92
Cdd:cd00143    4 GVSDKGGDRKTNEDAVV--------------IKPNLNNED-GGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSE 68
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  93 GNINSCavnINSYIKNTNNLIYNM--SVQYGARMGTTFAALLICGDRAQTFNLGDSRIYHVTDGEIVQLTKDHT-----E 165
Cdd:cd00143   69 EDIEEA---LRKAFLRADEEILEEaqDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKpvneeE 145
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153 166 AERLVRLGILSPEEASKsaSKNMLYKFLG-IPPKEGII-EADISESFFVKKGDVFLLCTDGLTNMVENERIKDVIN---T 240
Cdd:cd00143  146 RERIEKAGGRVSNGRVP--GVLAVTRALGdFDLKPGVSaEPDVTVVKLTEDDDFLILASDGLWDVLSNQEAVDIVRselA 223
                        250       260       270
                 ....*....|....*....|....*....|.
gi 125973153 241 ENTPSKAASKLINEALENGGFDNITCIVVKI 271
Cdd:cd00143  224 KEDLQEAAQELVDLALRRGSHDNITVVVVRL 254
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
2-272 3.63e-55

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 181.01  E-value: 3.63e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153   2 YSEKNIILRATAATHIGYVRSANEDNFYlngiffspsmtektILFDINEaDSFFLFAVSDGLGGEIRGDEAS---LTAMR 78
Cdd:COG0631    1 SSSGILSLKVAGLSDVGTVRKHNEDAFL--------------IKPNENG-NLLLLFAVADGMGGHAAGEVASklaVEALA 65
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  79 ELKKAHNLIKNNNNGNINscavnINSYIKNTNNLIY---NMSVQYgARMGTTFAALLICGDRAQTFNLGDSRIYHVTDGE 155
Cdd:COG0631   66 RLFDETNFNSLNESLEEL-----LKEAILKANEAIAeegQLNEDV-RGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGE 139
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153 156 IVQLTKDHTEAERLVRLGILSPEEASKSASKNMLYKFLGIPPKegiIEADIsESFFVKKGDVFLLCTDGLTNMVENERIK 235
Cdd:COG0631  140 LKQLTEDHSLVNRLEQRGIITPEEARSHPRRNALTRALGDFDL---LEPDI-TELELEPGDFLLLCSDGLWDVVSDDEIV 215
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 125973153 236 DVINTENTPSKAASKLINEALENGGFDNITCIVVKIE 272
Cdd:COG0631  216 DILKNSETPQEAADKLIELALEGGGPDNITVVLVRLN 252
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
2-269 4.18e-33

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 122.48  E-value: 4.18e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153     2 YSEKNIILRaTAATHIGYVRSANEDNFYLNGIFFspsmtektilfdineaDSFFLFAVSDGLGGeirgDEASLTAMRELK 81
Cdd:smart00332   2 VSGKNLGLR-YGLSSMQGVRKPMEDAHVITPDLS----------------DSGGFFGVFDGHGG----SEAAKFLSKNLP 60
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153    82 KAhnliKNNNNGNINSCAVNINSYIKNTNNLI-YNMSVQYGARMGTTFAALLICGDRAQTFNLGDSRIYHVTDGEIVQLT 160
Cdd:smart00332  61 EI----LAEELIKEKDELEDVEEALRKAFLSTdEEILEELEALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLT 136
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153   161 KDHT-----EAERLVRLGilspEEASKSASKNMLY---KFLGIPPKEGII-EADISESFFVKKGDVFLLCTDGLTNMVEN 231
Cdd:smart00332 137 EDHKpsnedERARIEAAG----GFVINGRVNGVLAlsrAIGDFFLKPYVSaEPDVTVVELTEKDDFLILASDGLWDVLSN 212
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|
gi 125973153   232 ERIKDVI--NTENTPSKAASKLINEALENGGFDNITCIVV 269
Cdd:smart00332 213 QEVVDIVrkHLSKDPKEAAKRLIDLALARGSKDNITVVVV 252
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
14-264 7.10e-17

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 76.63  E-value: 7.10e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153   14 ATHIGYVRSANEDNFYLNGIFFSPSmtektilfdinEADSFFLFAVSDGLGGEIRGDEASLTAMRELKKAhnlikNNNNG 93
Cdd:pfam00481   5 GTRMQGWRKSMEDAHIDGKNLNSSS-----------GKDSWSFFAVFDGHGGSEAAKYAGKHLHTILALR-----RSFLT 68
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153   94 NINSCAVNINSYIkNTNNLIYNMSVQYG-ARMGTTFAALLICGDRAQTFNLGDSRIYHVTDGE-IVQLTKDHT-----EA 166
Cdd:pfam00481  69 LRKLEDALRESFL-ETDEELRSDAANHEdLSSGSTAVVALIRGNKLYVANVGDSRAVLCRNGGaIKQLTEDHKpsdedER 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  167 ERLVRLG--------ILSPEEASKSAS-KNMLYKFLGIPPKEGIIEADISESffvkkgDVFL-LCTDGLTNMVENERIKD 236
Cdd:pfam00481 148 RRIRAAGgfvsrngrVNGVLAVSRAFGdFDLKPGEQPVSAEPDITSHKITED------DEFLiLACDGLWDVLSDQEVVD 221
                         250       260       270
                  ....*....|....*....|....*....|..
gi 125973153  237 VINTE----NTPSKAASKLINEALENGGFDNI 264
Cdd:pfam00481 222 IVRSNlsdgGDPMEAAEKLVDEAIAYGSEDNI 253
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
20-257 7.19e-16

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 72.77  E-value: 7.19e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153    20 VRSANEDNFYLNGIFFSpsmtektiLFDINEADsfFLFAVSDGLGGEIRGDEAS---LTAMRELKKAHNliknnnngnin 96
Cdd:smart00331   6 IAQYYEDATQVGGDFYD--------VVKLPEGR--LLIAIADVMGKGLAAALAMsmaRSALRTLLSEGI----------- 64
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153    97 scavNINSYIKNTNNLIYNMSVQygaRMGTTFAALLIC--GDRAQTFNLGDSRIYHVTDGEIVQLtkdHTEAERLVrlgi 174
Cdd:smart00331  65 ----SLSQILERLNRAIYENGED---GMFATLFLALYDfaGGTLSYANAGHSPPYLLRADGGLVE---DLDDLGAP---- 130
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153   175 lspeeasksasknmlykfLGIPPKegiIEADISEsFFVKKGDVFLLCTDGLTNMVENERIKDVI--NTENTPSKAASKLI 252
Cdd:smart00331 131 ------------------LGLEPD---VEVDVRE-LTLEPGDLLLLYTDGLTEARNPERLEELLeeLLGSPPAEIAQRIL 188

                   ....*
gi 125973153   253 NEALE 257
Cdd:smart00331 189 EELLE 193
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
46-257 8.42e-08

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 50.39  E-value: 8.42e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153   46 FDINEADSFFLFAVSDGLGGEIRGDEAS----LTAMRELKKAHNLIKNNNNGNINSCAVNINSYIKNTNNLIYNMSVQYG 121
Cdd:pfam13672  16 FAYRVLSDGWLIAVADGAGSAKYSDVGArlavEAAVEALRELLDSGELPELEALVRQILNDILALVRQEAAAQGLEPRDY 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  122 ArmgTTFAALLICGDRAQTFNLGDSRIYHV-TDGEIVQLTKDHTeaerlvrlGilspEEAsksaskNMLYkFLgiPPKEG 200
Cdd:pfam13672  96 A---TTLLLAVITPGGIVFFQIGDGAIVVRdRDGELQLLSEPDS--------G----EYA------NETT-FL--TSPDA 151
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 125973153  201 IIEADIsESFFVKKGDVFLLCTDGLTNMVENER-----IKDVINTENTPSkaASKLINEALE 257
Cdd:pfam13672 152 LEEFRI-RRLTLEPGDALALMTDGLSDSLVTEEpffpfFAPLLETLEEEG--ASEQLAEFLE 210
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
193-271 2.17e-05

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 43.05  E-value: 2.17e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  193 LGIPPkegiiEADI-SESFFVKKGDVFLLCTDGLT-------NMVENERIKDVI--NTENTPSKAASKLINEALENGGF- 261
Cdd:pfam07228 105 LGVLP-----DAPYeTAEFPLEPGDTLLLYTDGLTeardpdgELFGLERLLALLaeRHGLSPEELLDALLEDLLRLGGGe 179
                          90
                  ....*....|..
gi 125973153  262 --DNITCIVVKI 271
Cdd:pfam07228 180 leDDITLLVLRV 191
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
9-271 2.52e-19

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 86.65  E-value: 2.52e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153   9 LRATAATHIGYVRSANEDNFYLNgiffspSMTEKTILFDINEADSFFLFAVSDGLGGEIRGDEASLTAMRELK---KAHN 85
Cdd:PRK14559 375 LEDAGRTDVGRQRHHNEDYFGIN------TRIQKLENPHGRIVQARGLYILCDGMGGHAAGEVASALAVETLQqyfQQHW 448
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153  86 LIKNNNngninscAVNINSYIKNTNNLIYNMSVQ---YGA-RMGTTFAALLICGDRAQTFNLGDSRIYHVT-DGEIVQLT 160
Cdd:PRK14559 449 QDELPD-------EETIREAIYLANEAIYDLNQQnarSGSgRMGTTLVMALVQDTQVAVAHVGDSRLYRVTrKGGLEQLT 521
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153 161 KDHTEAERLVRLGiLSPEEASKSASKNMLYKFLGiPPKEGIIEADIsESFFVKKGDVFLLCTDGLTN--MVEN---ERIK 235
Cdd:PRK14559 522 VDHEVGQREIQRG-VEPQIAYARPDAYQLTQALG-PRDNSAIQPDI-QFLEIEEDTLLLLCSDGLSDndLLEThwqTHLL 598
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 125973153 236 DVINTENTPSKAASKLINEALENGGFDNITCIVVKI 271
Cdd:PRK14559 599 PLLSSSANLDQGLNKLIDLANQYNGHDNITAILVRL 634
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
121-273 4.93e-06

protein phosphatase 2C; Provisional


Pssm-ID: 240318 [Multi-domain]  Cd Length: 381  Bit Score: 45.92  E-value: 4.93e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153 121 GARMGTTFAA-----LLICgdraqtfNLGDSRIYHVTDGEIVQLTKDHT-----EAERLV---------RL-GILSPEEA 180
Cdd:PTZ00224 104 GGSTGTFCVImkdvhLQVG-------NVGDSRVLVCRDGKLVFATEDHKpnnpgERQRIEacggrvvsnRVdGDLAVSRA 176
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125973153 181 -------SKSASKNMLYKFLGIPpkegiieaDISESFFvKKGDVFLLCTDGL-TNMVENERIKDVIN--TENTPSKA--A 248
Cdd:PTZ00224 177 fgdrsfkVKGTGDYLEQKVIAVP--------DVTHLTC-QSNDFIILACDGVfEGNFSNEEVVAFVKeqLETCDDLAvvA 247
                        170       180
                 ....*....|....*....|....*
gi 125973153 249 SKLINEALENGGFDNITCIVVKIED 273
Cdd:PTZ00224 248 GRVCDEAIRRGSKDNISCLIVQLKD 272
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH