NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|119854936|ref|YP_935541|]
View 

hypothetical protein Mkms_5541 [Mycobacterium sp. KMS]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ABC1_ADCK3 cd13970
Activator of bc1 complex (ABC1) kinases, also called aarF domain containing kinase 3; This ...
92-345 1.33e-100

Activator of bc1 complex (ABC1) kinases, also called aarF domain containing kinase 3; This subfamily is composed of the atypical yeast protein kinase Abc1p, its human homolog ADCK3 (also called CABC1), and similar proteins. Abc1p (also called Coq8p) is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is necessary for the formation of a multi-subunit Q-biosynthetic complex and may also function in the regulation of Q synthesis. Human ADCK3 is able to rescue defects in Q synthesis and the phosphorylation state of Coq proteins in yeast Abc1 (or Coq8) mutants. Mutations in ADCK3 cause progressive cerebellar ataxia and atrophy due to Q10 deficiency. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Subfamily 13 (ABC1K13) of plant ABC1 kinases belongs in this subfamily with yeast Abc1p and human ADCK3. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


:

Pssm-ID: 270872  Cd Length: 251  Bit Score: 304.43  E-value: 1.33e-100
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  92 KAMSRLQADAPPMHPVLVHEVLEGELGSAV-EHFAEFTEEPMAAASIGQVHRAVLRDGRRVAVKIQYPGVAQAIRDDLAN 170
Cdd:cd13970    1 EALARLRDSAPPMPWAQLEKVLEAELGEDWrELFAEFDEEPFAAASIGQVHRATLKDGREVAVKVQYPGVAESIDSDLNN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 171 AELLATFLRFLAAstsgvKRDVKSVAREVAARISEEVDYRHEAATIAAFSELYRDHPFIRVPEVIAEMSTNRVLTMTYLD 250
Cdd:cd13970   81 LRRLLKLTGLLPK-----GLDLDALIAELREELLEECDYEREAANQRRFRELLADDPRFVVPEVIPELSTKRVLTTEFVD 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 251 GMDWAAAQQADQDLRNVWAETILRFAYGSFRHANLMHADPHPGNYRFNT-DGTVGFVDFGCVKVLPELQRWRQVAMNRAL 329
Cdd:cd13970  156 GVPLDEAADLSQEERNRIGELLLRLCLRELFEFGFMQTDPNPGNFLYDPeDGRLGLLDFGAVREYPPEFVDGYRRLVRAA 235
                        250
                 ....*....|....*.
gi 119854936 330 QEGRKQDLRDIMVLAG 345
Cdd:cd13970  236 LEGDREALLEASVELG 251
AarF COG0661
Predicted unusual protein kinase [General function prediction only]
12-353 1.51e-73

Predicted unusual protein kinase [General function prediction only]


:

Pssm-ID: 223733 [Multi-domain]  Cd Length: 517  Bit Score: 242.60  E-value: 1.51e-73
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  12 RIRRTMPLAGFTARAAGGRVIAGLREKAGQDGAVEQF-----HERTAERYAELLGHSRGVLMKVGQIMSlldTRA--VGT 84
Cdd:COG0661   12 RIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLAsseelREKRAERLRLALEELGPTFIKLGQILS---TRPdlVPP 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  85 ggfwPYQKAMSRLQADAPPMHPVLVHEVLEGELGSAV-EHFAEFTEEPMAAASIGQVHRAVLRDGRRVAVKIQYPGVAQA 163
Cdd:COG0661   89 ----EYAEELAKLQDRVPPFPFEEAERIIEEELGRPIeELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRER 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 164 IRDDLANAELLATFLRFLaaSTSGVKRDVKSVAREVAARISEEVDYRHEAATIAAFSELYRDHPFIRVPEVIAEMSTNRV 243
Cdd:COG0661  165 IEADLKLLRRLARLIKRL--PPGGRRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRV 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 244 LTMTYLDG---MDWAAAQQADQDLRNVwAETILR-FAYGSFRHaNLMHADPHPGNYRFNTDGTVGFVDFGCVKVLPELQR 319
Cdd:COG0661  243 LTMEWIDGikiSDIAALKSAGIDRKEL-AELLVRaFLRQLLRD-GFFHADPHPGNILVRSDGRIVLLDFGIVGRLDPKFR 320
                        330       340       350
                 ....*....|....*....|....*....|....
gi 119854936 320 WRQVAMNRALQEGRKQDLRDIMVLAGYLTADSDL 353
Cdd:COG0661  321 RYLAELLLAFLNRDYDRVAELHVELGYVPPDTDR 354
 
Name Accession Description Interval E-value
ABC1_ADCK3 cd13970
Activator of bc1 complex (ABC1) kinases, also called aarF domain containing kinase 3; This ...
92-345 1.33e-100

Activator of bc1 complex (ABC1) kinases, also called aarF domain containing kinase 3; This subfamily is composed of the atypical yeast protein kinase Abc1p, its human homolog ADCK3 (also called CABC1), and similar proteins. Abc1p (also called Coq8p) is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is necessary for the formation of a multi-subunit Q-biosynthetic complex and may also function in the regulation of Q synthesis. Human ADCK3 is able to rescue defects in Q synthesis and the phosphorylation state of Coq proteins in yeast Abc1 (or Coq8) mutants. Mutations in ADCK3 cause progressive cerebellar ataxia and atrophy due to Q10 deficiency. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Subfamily 13 (ABC1K13) of plant ABC1 kinases belongs in this subfamily with yeast Abc1p and human ADCK3. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270872  Cd Length: 251  Bit Score: 304.43  E-value: 1.33e-100
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  92 KAMSRLQADAPPMHPVLVHEVLEGELGSAV-EHFAEFTEEPMAAASIGQVHRAVLRDGRRVAVKIQYPGVAQAIRDDLAN 170
Cdd:cd13970    1 EALARLRDSAPPMPWAQLEKVLEAELGEDWrELFAEFDEEPFAAASIGQVHRATLKDGREVAVKVQYPGVAESIDSDLNN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 171 AELLATFLRFLAAstsgvKRDVKSVAREVAARISEEVDYRHEAATIAAFSELYRDHPFIRVPEVIAEMSTNRVLTMTYLD 250
Cdd:cd13970   81 LRRLLKLTGLLPK-----GLDLDALIAELREELLEECDYEREAANQRRFRELLADDPRFVVPEVIPELSTKRVLTTEFVD 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 251 GMDWAAAQQADQDLRNVWAETILRFAYGSFRHANLMHADPHPGNYRFNT-DGTVGFVDFGCVKVLPELQRWRQVAMNRAL 329
Cdd:cd13970  156 GVPLDEAADLSQEERNRIGELLLRLCLRELFEFGFMQTDPNPGNFLYDPeDGRLGLLDFGAVREYPPEFVDGYRRLVRAA 235
                        250
                 ....*....|....*.
gi 119854936 330 QEGRKQDLRDIMVLAG 345
Cdd:cd13970  236 LEGDREALLEASVELG 251
ABC1 pfam03109
ABC1 family; This family includes ABC1 from yeast and AarF from Escherichia coli. These ...
116-235 8.95e-35

ABC1 family; This family includes ABC1 from yeast and AarF from Escherichia coli. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex and Escherichia coli AarF is required for ubiquinone production. It has been suggested that members of the ABC1 family are novel chaperonins. These proteins are unrelated to the ABC transporter proteins.


Pssm-ID: 111949  Cd Length: 117  Bit Score: 126.17  E-value: 8.95e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  116 ELGSAV-EHFAEFTEEPMAAASIGQVHRAVLRDGRRVAVKIQYPGVAQAIRDDLANAELLATFLRFLaastsGVKRDVKS 194
Cdd:pfam03109   2 ELGAPVeEVFAEFDEEPIAAASIAQVHRAVLKDGEEVAVKVQRPGVKKRIRSDLKLLKFLAKILKKF-----FPGFDLDW 76
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 119854936  195 VAREVAARISEEVDYRHEAATIAAFSELYRDHPFIRVPEVI 235
Cdd:pfam03109  77 LVDEFRKSLPQELDFLREAANAEKFRENFADLPWVYVPKVY 117
ubiB PRK04750
putative ubiquinone biosynthesis protein UbiB; Reviewed
66-316 6.07e-24

putative ubiquinone biosynthesis protein UbiB; Reviewed


Pssm-ID: 235310  Cd Length: 537  Bit Score: 103.45  E-value: 6.07e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  66 VLMKVGQIMSlldTRAvgtgGFWPYQKA--MSRLQADAPPMHPVLVHEVLEGELGSAVEH-FAEFTEEPMAAASIGQVHR 142
Cdd:PRK04750  65 IFVKFGQMLS---TRR----DLFPPDIAdeLALLQDRVPPFDGALARAIIEKALGGPVEEwFDDFDIKPLASASIAQVHF 137
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 143 AVLRD-GRRVAVKIQYPGVAQAIRDDLANAELLATFLRFLaaSTSGVKRDVKSVAREVAARISEEVDYRHEAATIAAFSE 221
Cdd:PRK04750 138 ARLKDnGREVVVKVLRPDILPVIDADLALMYRLARWVERL--LPDGRRLKPREVVAEFEKTLHDELDLMREAANASQLRR 215
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 222 LYRDHPFIRVPEVIAEMSTNRVLTMTYLDGM---DWAAAQQADQDLRNVWAETILRFAYGSFRHaNLMHADPHPGN---- 294
Cdd:PRK04750 216 NFEDSDMLYVPEVYWDYCSETVMVMERMYGIpvsDVAALRAAGTDMKLLAERGVEVFFTQVFRD-GFFHADMHPGNifvs 294
                        250       260
                 ....*....|....*....|..
gi 119854936 295 YRFNTDGTVGFVDFGCVKVLPE 316
Cdd:PRK04750 295 YDPPENPRYIALDFGIVGSLNK 316
AarF COG0661
Predicted unusual protein kinase [General function prediction only]
12-353 1.51e-73

Predicted unusual protein kinase [General function prediction only]


Pssm-ID: 223733 [Multi-domain]  Cd Length: 517  Bit Score: 242.60  E-value: 1.51e-73
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  12 RIRRTMPLAGFTARAAGGRVIAGLREKAGQDGAVEQF-----HERTAERYAELLGHSRGVLMKVGQIMSlldTRA--VGT 84
Cdd:COG0661   12 RIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLAsseelREKRAERLRLALEELGPTFIKLGQILS---TRPdlVPP 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  85 ggfwPYQKAMSRLQADAPPMHPVLVHEVLEGELGSAV-EHFAEFTEEPMAAASIGQVHRAVLRDGRRVAVKIQYPGVAQA 163
Cdd:COG0661   89 ----EYAEELAKLQDRVPPFPFEEAERIIEEELGRPIeELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRER 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 164 IRDDLANAELLATFLRFLaaSTSGVKRDVKSVAREVAARISEEVDYRHEAATIAAFSELYRDHPFIRVPEVIAEMSTNRV 243
Cdd:COG0661  165 IEADLKLLRRLARLIKRL--PPGGRRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRV 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 244 LTMTYLDG---MDWAAAQQADQDLRNVwAETILR-FAYGSFRHaNLMHADPHPGNYRFNTDGTVGFVDFGCVKVLPELQR 319
Cdd:COG0661  243 LTMEWIDGikiSDIAALKSAGIDRKEL-AELLVRaFLRQLLRD-GFFHADPHPGNILVRSDGRIVLLDFGIVGRLDPKFR 320
                        330       340       350
                 ....*....|....*....|....*....|....
gi 119854936 320 WRQVAMNRALQEGRKQDLRDIMVLAGYLTADSDL 353
Cdd:COG0661  321 RYLAELLLAFLNRDYDRVAELHVELGYVPPDTDR 354
UbiB TIGR01982
2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the ...
69-440 5.56e-46

2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].


Pssm-ID: 233667 [Multi-domain]  Cd Length: 437  Bit Score: 166.32  E-value: 5.56e-46
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936   69 KVGQIMSlldTRA--VGTggfwPYQKAMSRLQADAPPMHPVLVHEVLEGELGSAVEH-FAEFTEEPMAAASIGQVHRAVL 145
Cdd:TIGR01982  66 KFGQTLS---TRAdlLPA----DIAEELSLLQDRVPPFDFKVARKVIEAALGGPLEElFAEFEEKPLAAASIAQVHRARL 138
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  146 RDGRRVAVKIQYPGVAQAIRDDLANAELLATFL-RFLAAStsgvKR-DVKSVAREVAARISEEVDYRHEAATIAAFSELY 223
Cdd:TIGR01982 139 VDGKEVAVKVLRPGIEKTIAADIALLYRLARIVeRLSPDS----RRlRPTEVVKEFEKTLRRELDLRREAANASELGENF 214
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  224 RDHPFIRVPEVIAEMSTNRVLTMTYLDGM---DWAAAQQADQDLRNVwAETILR-FAYGSFRHaNLMHADPHPGNYRFNT 299
Cdd:TIGR01982 215 KNDPGVYVPEVYWDRTSERVLTMEWIDGIplsDIAALDEAGLDRKAL-AENLARsFLNQVLRD-GFFHADLHPGNIFVLK 292
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  300 DGTVGFVDFGCVKVLPElQRWRQVAMN-RALQEGRKQDLRDIMVLAGYLTADSDLtaDELYQwQSELLGECMATTP-QPV 377
Cdd:TIGR01982 293 DGKIIALDFGIVGRLSE-EDRRYLAEIlYGFLNRDYRRVAEVHFDAGYVPSDTDM--AEFEQ-AIRAIGEPIFGQPlKEI 368
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 119854936  378 tytadSINRVVRCLFDV-RDTNhpvarMTAPDDYVFAARLQLAVSSVCAGLNATLPVRAIVEDF 440
Cdd:TIGR01982 369 -----SVGRLLAGLFKItRDFN-----MELQPQLLLLQKTLLTVEGVGRQLDPDLNMWKVAEPF 422
 
Name Accession Description Interval E-value
ABC1_ADCK3 cd13970
Activator of bc1 complex (ABC1) kinases, also called aarF domain containing kinase 3; This ...
92-345 1.33e-100

Activator of bc1 complex (ABC1) kinases, also called aarF domain containing kinase 3; This subfamily is composed of the atypical yeast protein kinase Abc1p, its human homolog ADCK3 (also called CABC1), and similar proteins. Abc1p (also called Coq8p) is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is necessary for the formation of a multi-subunit Q-biosynthetic complex and may also function in the regulation of Q synthesis. Human ADCK3 is able to rescue defects in Q synthesis and the phosphorylation state of Coq proteins in yeast Abc1 (or Coq8) mutants. Mutations in ADCK3 cause progressive cerebellar ataxia and atrophy due to Q10 deficiency. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Subfamily 13 (ABC1K13) of plant ABC1 kinases belongs in this subfamily with yeast Abc1p and human ADCK3. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270872  Cd Length: 251  Bit Score: 304.43  E-value: 1.33e-100
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  92 KAMSRLQADAPPMHPVLVHEVLEGELGSAV-EHFAEFTEEPMAAASIGQVHRAVLRDGRRVAVKIQYPGVAQAIRDDLAN 170
Cdd:cd13970    1 EALARLRDSAPPMPWAQLEKVLEAELGEDWrELFAEFDEEPFAAASIGQVHRATLKDGREVAVKVQYPGVAESIDSDLNN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 171 AELLATFLRFLAAstsgvKRDVKSVAREVAARISEEVDYRHEAATIAAFSELYRDHPFIRVPEVIAEMSTNRVLTMTYLD 250
Cdd:cd13970   81 LRRLLKLTGLLPK-----GLDLDALIAELREELLEECDYEREAANQRRFRELLADDPRFVVPEVIPELSTKRVLTTEFVD 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 251 GMDWAAAQQADQDLRNVWAETILRFAYGSFRHANLMHADPHPGNYRFNT-DGTVGFVDFGCVKVLPELQRWRQVAMNRAL 329
Cdd:cd13970  156 GVPLDEAADLSQEERNRIGELLLRLCLRELFEFGFMQTDPNPGNFLYDPeDGRLGLLDFGAVREYPPEFVDGYRRLVRAA 235
                        250
                 ....*....|....*.
gi 119854936 330 QEGRKQDLRDIMVLAG 345
Cdd:cd13970  236 LEGDREALLEASVELG 251
ABC1_ADCK3-like cd05121
Activator of bc1 complex (ABC1) kinases (also called aarF domain containing kinase 3) and ...
96-341 1.83e-72

Activator of bc1 complex (ABC1) kinases (also called aarF domain containing kinase 3) and similar proteins; This family is composed of the atypical yeast protein kinase Abc1p, its human homolog ADCK3 (also called CABC1), and similar proteins. Abc1p (also called Coq8p) is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is necessary for the formation of a multi-subunit Q-biosynthetic complex and may also function in the regulation of Q synthesis. Human ADCK3 is able to rescue defects in Q synthesis and the phosphorylation state of Coq proteins in yeast Abc1 (or Coq8) mutants. Mutations in ADCK3 cause progressive cerebellar ataxia and atrophy due to Q10 deficiency. Eukaryotes contain at least two more ABC1/ADCK3-like proteins: in humans, these are the putative atypical protein kinases named ADCK1 and ADCK2. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Eight of these plant ABC1 kinase subfamilies (ABC1K1-8) are specific for photosynthetic organisms. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270691 [Multi-domain]  Cd Length: 247  Bit Score: 231.62  E-value: 1.83e-72
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  96 RLQADAPPMHPVLVHEVLEGELGSAV-EHFAEFTEEPMAAASIGQVHRAVLRDGRRVAVKIQYPGVAQAIRDDLANAELL 174
Cdd:cd05121    1 KLQDDVPPFPFEEVRKIIEEELGRPLeEVFAEFDPEPLAAASIAQVHRARLKDGREVAVKVQRPGIEEIIEADLRILRRL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 175 ATFLRFLaaSTSGVKRDVKSVAREVAARISEEVDYRHEAATIAAFSELYRDHPFIRVPEVIAEMSTNRVLTMTYLDGM-- 252
Cdd:cd05121   81 ARLLERL--SPLLRRLDLVAIVDEFARSLLEELDFRREARNAERFRKNLKDSPDVYVPKVYPELSTRRVLVMEYIDGVkl 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 253 -DWAAAQQADQDLRNVwAETILR-FAYGSFRHaNLMHADPHPGNYRFNTDGTVGFVDFGCVKVLPELQRWRQVAMNRALQ 330
Cdd:cd05121  159 tDLEALRAAGIDRKEL-ARRLVDaYLKQIFED-GFFHADPHPGNILVLPDGRIALLDFGMVGRLDPETREALADLLLALV 236
                        250
                 ....*....|.
gi 119854936 331 EGRKQDLRDIM 341
Cdd:cd05121  237 NGDAEGLAEAL 247
ADCK1-like cd13969
aarF domain containing kinase 1 and similar proteins; This subfamily is composed of ...
97-294 5.17e-45

aarF domain containing kinase 1 and similar proteins; This subfamily is composed of uncharacterized ABC1 kinase-like proteins including the human protein called aarF domain containing kinase 1 (ADCK1). Eukaryotes contain at least three ABC1-like proteins: in humans, these are ADCK3 and the putative protein kinases named ADCK1 and ADCK2. Yeast Abc1p and its human homolog ADCK3 are atypical protein kinases required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Plant subfamilies 14 and 15 (ABC1K14-15) belong to the same group of ABC1 kinases as human ADCK1. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270871  Cd Length: 253  Bit Score: 158.80  E-value: 5.17e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  97 LQADAPPMHPVLVHEVLEGELGSAVEH-FAEFTEEPMAAASIGQVHRAVLRDGRRVAVKIQYPGVAQAIRDDLANAELLA 175
Cdd:cd13969    2 LQDKAPQSPYEEVRRVFKEDLGKPPEElFSEFDEEPIASASLAQVHKAKLKDGEEVAVKVQHPDLRKQFAGDLATMEFLV 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 176 TFLRFLAASTsgvkrDVKSVAREVAARISEEVDYRHEAATIAAFSELYRDHPFIRVPEVIAEMSTNRVLTMTYLDG---M 252
Cdd:cd13969   82 NLVEKLFPDF-----PFSWLVDELKKNLPKELDFLNEARNAERCAKLFKHRPDVYVPKVYWDLSSKRVLTMEFIDGikiD 156
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 119854936 253 DWAAAQQADQDLRNVwAETILR-FAYGSFRHAnLMHADPHPGN 294
Cdd:cd13969  157 DVEALKKLGIDPKEV-ARLLSEaFAEMIFVHG-FVHCDPHPGN 197
UbiB cd13972
Ubiquinone biosynthetic protein UbiB; UbiB is the prokaryotic homolog of yeast Abc1p and human ...
96-309 2.73e-39

Ubiquinone biosynthetic protein UbiB; UbiB is the prokaryotic homolog of yeast Abc1p and human ADCK3 (aarF domain containing kinase 3). It is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is required in the first monooxygenase step in Q biosynthesis. Mutant strains with disrupted ubiB genes lack Q and accumulate octaprenylphenol, a Q biosynthetic intermediate.


Pssm-ID: 270874  Cd Length: 247  Bit Score: 143.11  E-value: 2.73e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  96 RLQADAPPMHPVLVHEVLEGELGSAVEH-FAEFTEEPMAAASIGQVHRAVLRDGRRVAVKIQYPGVAQAIRDDLANAELL 174
Cdd:cd13972    1 KLQDRVPPFSGKEARAIIEAELGKPLDAlFSDFDEEPVAAASIAQVHKARLLDGREVAVKVLRPGIEKRIERDLELLRFL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 175 ATFLRFLAASTSGVKrdVKSVAREVAARISEEVDYRHEAATIAAFSELYRDHPFIRVPEVIAEMSTNRVLTMTYLDGM-- 252
Cdd:cd13972   81 ARLAERLLPEARRLR--PVEVVKEFARSLLLELDLRLEAANASELRENFLDDPGFYVPEVYWELTSKNVLTMEWIDGIpi 158
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 119854936 253 -DWAAAQQADQDLRNVWAETILRFAYGSFRHaNLMHADPHPGNYRFNTDGTVGFVDFG 309
Cdd:cd13972  159 sDIEALDAAGIDRKALAERLVEIFFRQVFRD-GFFHADMHPGNIFVDPNGRIIAVDFG 215
ABC1 pfam03109
ABC1 family; This family includes ABC1 from yeast and AarF from Escherichia coli. These ...
116-235 8.95e-35

ABC1 family; This family includes ABC1 from yeast and AarF from Escherichia coli. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex and Escherichia coli AarF is required for ubiquinone production. It has been suggested that members of the ABC1 family are novel chaperonins. These proteins are unrelated to the ABC transporter proteins.


Pssm-ID: 111949  Cd Length: 117  Bit Score: 126.17  E-value: 8.95e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  116 ELGSAV-EHFAEFTEEPMAAASIGQVHRAVLRDGRRVAVKIQYPGVAQAIRDDLANAELLATFLRFLaastsGVKRDVKS 194
Cdd:pfam03109   2 ELGAPVeEVFAEFDEEPIAAASIAQVHRAVLKDGEEVAVKVQRPGVKKRIRSDLKLLKFLAKILKKF-----FPGFDLDW 76
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 119854936  195 VAREVAARISEEVDYRHEAATIAAFSELYRDHPFIRVPEVI 235
Cdd:pfam03109  77 LVDEFRKSLPQELDFLREAANAEKFRENFADLPWVYVPKVY 117
ubiB PRK04750
putative ubiquinone biosynthesis protein UbiB; Reviewed
66-316 6.07e-24

putative ubiquinone biosynthesis protein UbiB; Reviewed


Pssm-ID: 235310  Cd Length: 537  Bit Score: 103.45  E-value: 6.07e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  66 VLMKVGQIMSlldTRAvgtgGFWPYQKA--MSRLQADAPPMHPVLVHEVLEGELGSAVEH-FAEFTEEPMAAASIGQVHR 142
Cdd:PRK04750  65 IFVKFGQMLS---TRR----DLFPPDIAdeLALLQDRVPPFDGALARAIIEKALGGPVEEwFDDFDIKPLASASIAQVHF 137
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 143 AVLRD-GRRVAVKIQYPGVAQAIRDDLANAELLATFLRFLaaSTSGVKRDVKSVAREVAARISEEVDYRHEAATIAAFSE 221
Cdd:PRK04750 138 ARLKDnGREVVVKVLRPDILPVIDADLALMYRLARWVERL--LPDGRRLKPREVVAEFEKTLHDELDLMREAANASQLRR 215
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 222 LYRDHPFIRVPEVIAEMSTNRVLTMTYLDGM---DWAAAQQADQDLRNVWAETILRFAYGSFRHaNLMHADPHPGN---- 294
Cdd:PRK04750 216 NFEDSDMLYVPEVYWDYCSETVMVMERMYGIpvsDVAALRAAGTDMKLLAERGVEVFFTQVFRD-GFFHADMHPGNifvs 294
                        250       260
                 ....*....|....*....|..
gi 119854936 295 YRFNTDGTVGFVDFGCVKVLPE 316
Cdd:PRK04750 295 YDPPENPRYIALDFGIVGSLNK 316
ADCK2-like cd13971
aarF domain containing kinase 2 and similar proteins; This subfamily is composed of ...
96-301 2.43e-22

aarF domain containing kinase 2 and similar proteins; This subfamily is composed of uncharacterized ABC1 kinase-like proteins including the human protein called aarF domain containing kinase 2 (ADCK2). Eukaryotes contain at least three ABC1-like proteins; in humans, these are ADCK3 and the putative protein kinases named ADCK1 and ADCK2. Yeast Abc1p and its human homolog ADCK3 are atypical protein kinases required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Plant subfamily 10 (ABC1K10) belong to the same group of ABC1 kinases as human ADCK2. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270873 [Multi-domain]  Cd Length: 298  Bit Score: 95.75  E-value: 2.43e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  96 RLQADAPPmHPVLvH--EVLEGELGSAVEH-FAEFTEEPMAAASIGQVHRAVLRD--------GRRVAVKIQYPGVAQAI 164
Cdd:cd13971    1 KLHSNAPP-HSWA-HteRALEAAFGKDWEDiFEEFDEEPIGSGSIAQVHRAKLKPdyggdgggPRVVAVKVLHPGVREQI 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 165 RDDLAnaellatFLRFLAASTSGVK----RDVKSVAREVAARISEEVDYRHEAATIAAFSELYRDHPFIRVPEVIAEMST 240
Cdd:cd13971   79 ERDLA-------ILRLFAKLLEAIPplrwLSLPESVEQFASLMLRQLDLRVEAANLERFRENFKDRKDVSFPKPLYPLVT 151
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 119854936 241 NRVLTMTYLDG--MDWAAAQQADQDLRNVWAETILR-FAYGSFRHaNLMHADPHPGN--YRFNTDG 301
Cdd:cd13971  152 EEVLVETFEEGvpISRTVLAHGGEPLKRKLARIGLDaFLKMLFVD-NFVHGDLHPGNilVRFNDSN 216
AarF COG0661
Predicted unusual protein kinase [General function prediction only]
12-353 1.51e-73

Predicted unusual protein kinase [General function prediction only]


Pssm-ID: 223733 [Multi-domain]  Cd Length: 517  Bit Score: 242.60  E-value: 1.51e-73
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  12 RIRRTMPLAGFTARAAGGRVIAGLREKAGQDGAVEQF-----HERTAERYAELLGHSRGVLMKVGQIMSlldTRA--VGT 84
Cdd:COG0661   12 RIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLAsseelREKRAERLRLALEELGPTFIKLGQILS---TRPdlVPP 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  85 ggfwPYQKAMSRLQADAPPMHPVLVHEVLEGELGSAV-EHFAEFTEEPMAAASIGQVHRAVLRDGRRVAVKIQYPGVAQA 163
Cdd:COG0661   89 ----EYAEELAKLQDRVPPFPFEEAERIIEEELGRPIeELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRER 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 164 IRDDLANAELLATFLRFLaaSTSGVKRDVKSVAREVAARISEEVDYRHEAATIAAFSELYRDHPFIRVPEVIAEMSTNRV 243
Cdd:COG0661  165 IEADLKLLRRLARLIKRL--PPGGRRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRV 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936 244 LTMTYLDG---MDWAAAQQADQDLRNVwAETILR-FAYGSFRHaNLMHADPHPGNYRFNTDGTVGFVDFGCVKVLPELQR 319
Cdd:COG0661  243 LTMEWIDGikiSDIAALKSAGIDRKEL-AELLVRaFLRQLLRD-GFFHADPHPGNILVRSDGRIVLLDFGIVGRLDPKFR 320
                        330       340       350
                 ....*....|....*....|....*....|....
gi 119854936 320 WRQVAMNRALQEGRKQDLRDIMVLAGYLTADSDL 353
Cdd:COG0661  321 RYLAELLLAFLNRDYDRVAELHVELGYVPPDTDR 354
UbiB TIGR01982
2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the ...
69-440 5.56e-46

2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].


Pssm-ID: 233667 [Multi-domain]  Cd Length: 437  Bit Score: 166.32  E-value: 5.56e-46
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936   69 KVGQIMSlldTRA--VGTggfwPYQKAMSRLQADAPPMHPVLVHEVLEGELGSAVEH-FAEFTEEPMAAASIGQVHRAVL 145
Cdd:TIGR01982  66 KFGQTLS---TRAdlLPA----DIAEELSLLQDRVPPFDFKVARKVIEAALGGPLEElFAEFEEKPLAAASIAQVHRARL 138
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  146 RDGRRVAVKIQYPGVAQAIRDDLANAELLATFL-RFLAAStsgvKR-DVKSVAREVAARISEEVDYRHEAATIAAFSELY 223
Cdd:TIGR01982 139 VDGKEVAVKVLRPGIEKTIAADIALLYRLARIVeRLSPDS----RRlRPTEVVKEFEKTLRRELDLRREAANASELGENF 214
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  224 RDHPFIRVPEVIAEMSTNRVLTMTYLDGM---DWAAAQQADQDLRNVwAETILR-FAYGSFRHaNLMHADPHPGNYRFNT 299
Cdd:TIGR01982 215 KNDPGVYVPEVYWDRTSERVLTMEWIDGIplsDIAALDEAGLDRKAL-AENLARsFLNQVLRD-GFFHADLHPGNIFVLK 292
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119854936  300 DGTVGFVDFGCVKVLPElQRWRQVAMN-RALQEGRKQDLRDIMVLAGYLTADSDLtaDELYQwQSELLGECMATTP-QPV 377
Cdd:TIGR01982 293 DGKIIALDFGIVGRLSE-EDRRYLAEIlYGFLNRDYRRVAEVHFDAGYVPSDTDM--AEFEQ-AIRAIGEPIFGQPlKEI 368
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 119854936  378 tytadSINRVVRCLFDV-RDTNhpvarMTAPDDYVFAARLQLAVSSVCAGLNATLPVRAIVEDF 440
Cdd:TIGR01982 369 -----SVGRLLAGLFKItRDFN-----MELQPQLLLLQKTLLTVEGVGRQLDPDLNMWKVAEPF 422
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH