NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|119607129|gb|EAW86723|]
View 

opioid receptor, kappa 1 [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_4 super family cl21561
Olfactory receptor; The members of this family are transmembrane olfactory receptors.
71-271 1.61e-07

Olfactory receptor; The members of this family are transmembrane olfactory receptors.


The actual alignment was detected with superfamily member pfam10328:

Pssm-ID: 304433  Cd Length: 274  Bit Score: 50.66  E-value: 1.61e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129   71 VVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTT----------MPFQSTVYLMNSWpfgdvLCKIVISIDYY 140
Cdd:pfam10328   5 LFGIILNWLIFYIFLKLPSLKNSFGILCANKAISNAIICTIflfyvvpmtlLDLSFLPELLNSH-----IGGLVLLGLYE 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  141 nmfTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSsvgISAIVLGgtkvredvDVIECSLQFPDDDYS 220
Cdd:pfam10328  80 ---ISPLTHLLISLNRFCAVFFPFKYKKIFSIKNTKIIITIIWIISI---IISTLFY--------LPLGCHFYYSPETLT 145
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 119607129  221 WW------DLFMKICVFIFAFVIPVLIIIV-CYTLMILRLKSVRLLSGSREKDRNLRR 271
Cdd:pfam10328 146 WSfdeppcAEITWYGDFLKNLVLVIITNIInVITFIKLRKFSKKSALSSEESKKRRKK 203
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
76-330 1.07e-66

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


:

Pssm-ID: 278431 [Multi-domain]  Cd Length: 254  Bit Score: 214.09  E-value: 1.07e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129   76 GNSLVMFVIIRYTKMKTATNIYIFNLALADALVTT-TMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSV 154
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLlTLPFWLVYALFGTWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  155 DRYIAVCHPVKALdfRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPdddYSWWDLFMKICVFIFA 234
Cdd:pfam00001  81 DRYLAIVHPLRYR--RIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIPSNGVTSCLITFP---ESLWPVSYLLFSTVVG 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  235 FVIPVLIIIVCYTLMILRLKSVRLlsGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG-----STSHSTAAL 309
Cdd:pfam00001 156 FLLPLLVILVCYTRIIRTLRKQAR--SRRRSVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCdlliiISCVVTPPR 233
                         250       260
                  ....*....|....*....|.
gi 119607129  310 SSYYFCIALGYTNSSLNPILY 330
Cdd:pfam00001 234 TLLQLTVWLAYSNSCLNPIIY 254
 
Name Accession Description Interval E-value
7TM_GPCR_Srx pfam10328
Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis ...
71-271 1.61e-07

Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srx is part of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


Pssm-ID: 287318  Cd Length: 274  Bit Score: 50.66  E-value: 1.61e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129   71 VVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTT----------MPFQSTVYLMNSWpfgdvLCKIVISIDYY 140
Cdd:pfam10328   5 LFGIILNWLIFYIFLKLPSLKNSFGILCANKAISNAIICTIflfyvvpmtlLDLSFLPELLNSH-----IGGLVLLGLYE 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  141 nmfTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSsvgISAIVLGgtkvredvDVIECSLQFPDDDYS 220
Cdd:pfam10328  80 ---ISPLTHLLISLNRFCAVFFPFKYKKIFSIKNTKIIITIIWIISI---IISTLFY--------LPLGCHFYYSPETLT 145
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 119607129  221 WW------DLFMKICVFIFAFVIPVLIIIV-CYTLMILRLKSVRLLSGSREKDRNLRR 271
Cdd:pfam10328 146 WSfdeppcAEITWYGDFLKNLVLVIITNIInVITFIKLRKFSKKSALSSEESKKRRKK 203
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
76-330 1.07e-66

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431 [Multi-domain]  Cd Length: 254  Bit Score: 214.09  E-value: 1.07e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129   76 GNSLVMFVIIRYTKMKTATNIYIFNLALADALVTT-TMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSV 154
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLlTLPFWLVYALFGTWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  155 DRYIAVCHPVKALdfRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPdddYSWWDLFMKICVFIFA 234
Cdd:pfam00001  81 DRYLAIVHPLRYR--RIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIPSNGVTSCLITFP---ESLWPVSYLLFSTVVG 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  235 FVIPVLIIIVCYTLMILRLKSVRLlsGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG-----STSHSTAAL 309
Cdd:pfam00001 156 FLLPLLVILVCYTRIIRTLRKQAR--SRRRSVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCdlliiISCVVTPPR 233
                         250       260
                  ....*....|....*....|.
gi 119607129  310 SSYYFCIALGYTNSSLNPILY 330
Cdd:pfam00001 234 TLLQLTVWLAYSNSCLNPIIY 254
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
61-337 3.54e-39

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 143.38  E-value: 3.54e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  61 IITAVYSVVFVVGLVGNSLVMFVIiRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYY 140
Cdd:PHA03087  42 ILIVVYSTIFFFGLVGNIIVIYVL-TKTKIKTPMDIYLLNLAVSDLLFVMTLPFQIYYYILFQWSFGEFACKIVSGLYYI 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129 141 NMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKvrEDVDVIECSLqFPDDDYS 220
Cdd:PHA03087 121 GFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTK--KDHETLICCM-FYNNKTM 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129 221 WWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKsvrllsGSREKDRNLRRItRLVLVVVAVFVVCWTPIHIFILVEALG 300
Cdd:PHA03087 198 NWKLFINFEINIIGMLIPLTILLYCYSKILITLK------GINKSKKNKKAI-KLVLIIVILFVIFWLPFNVSVFVYSLH 270
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
gi 119607129 301 STSHSTA--ALSSYYF------CIALgyTNSSLNPILYAFLDENF 337
Cdd:PHA03087 271 ILHFKSGckAVKYIQYalhvteIISL--SHCCINPLIYAFVSEFF 313
 
Name Accession Description Interval E-value
7TM_GPCR_Srx pfam10328
Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis ...
71-271 1.61e-07

Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srx is part of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


Pssm-ID: 287318  Cd Length: 274  Bit Score: 50.66  E-value: 1.61e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129   71 VVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTT----------MPFQSTVYLMNSWpfgdvLCKIVISIDYY 140
Cdd:pfam10328   5 LFGIILNWLIFYIFLKLPSLKNSFGILCANKAISNAIICTIflfyvvpmtlLDLSFLPELLNSH-----IGGLVLLGLYE 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  141 nmfTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSsvgISAIVLGgtkvredvDVIECSLQFPDDDYS 220
Cdd:pfam10328  80 ---ISPLTHLLISLNRFCAVFFPFKYKKIFSIKNTKIIITIIWIISI---IISTLFY--------LPLGCHFYYSPETLT 145
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 119607129  221 WW------DLFMKICVFIFAFVIPVLIIIV-CYTLMILRLKSVRLLSGSREKDRNLRR 271
Cdd:pfam10328 146 WSfdeppcAEITWYGDFLKNLVLVIITNIInVITFIKLRKFSKKSALSSEESKKRRKK 203
7TM_GPCR_Srsx pfam10320
Serpentine type 7TM GPCR chemoreceptor Srsx; Chemoreception is mediated in Caenorhabditis ...
70-245 9.08e-05

Serpentine type 7TM GPCR chemoreceptor Srsx; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srsx is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


Pssm-ID: 255903  Cd Length: 257  Bit Score: 42.20  E-value: 9.08e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129   70 FVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADAL-VTTTMPFqsTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFT 148
Cdd:pfam10320   1 SVIGLFGNVLMIHLTFRKKKLRSKCSILICVQCIAHLIcLCGEIVF--VVLLFTGTQLTRNECFWMISFYIFGQTAQGPL 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  149 LTMMSVDRYIAVCHPVKaldFRTPLKAKIinICIWLLSSSVGISAIVLGGTKVREDVDVIECS--LQFPDDDYSWWDLFM 226
Cdd:pfam10320  79 MLMIGIDRLIAVKFPIF---YRLLSSSKY--LFIQLIFPVIYSSFITVYGFLQRDDETIIVCAppLALPGTAFTIFTLSS 153
                         170
                  ....*....|....*....
gi 119607129  227 kicVFIFAFVIPVLIIIVC 245
Cdd:pfam10320 154 ---LFINVIVLIVYIILII 169
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
76-330 1.07e-66

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431 [Multi-domain]  Cd Length: 254  Bit Score: 214.09  E-value: 1.07e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129   76 GNSLVMFVIIRYTKMKTATNIYIFNLALADALVTT-TMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSV 154
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLlTLPFWLVYALFGTWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  155 DRYIAVCHPVKALdfRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPdddYSWWDLFMKICVFIFA 234
Cdd:pfam00001  81 DRYLAIVHPLRYR--RIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIPSNGVTSCLITFP---ESLWPVSYLLFSTVVG 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  235 FVIPVLIIIVCYTLMILRLKSVRLlsGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG-----STSHSTAAL 309
Cdd:pfam00001 156 FLLPLLVILVCYTRIIRTLRKQAR--SRRRSVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCdlliiISCVVTPPR 233
                         250       260
                  ....*....|....*....|.
gi 119607129  310 SSYYFCIALGYTNSSLNPILY 330
Cdd:pfam00001 234 TLLQLTVWLAYSNSCLNPIIY 254
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
61-337 3.54e-39

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 143.38  E-value: 3.54e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  61 IITAVYSVVFVVGLVGNSLVMFVIiRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYY 140
Cdd:PHA03087  42 ILIVVYSTIFFFGLVGNIIVIYVL-TKTKIKTPMDIYLLNLAVSDLLFVMTLPFQIYYYILFQWSFGEFACKIVSGLYYI 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129 141 NMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKvrEDVDVIECSLqFPDDDYS 220
Cdd:PHA03087 121 GFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTK--KDHETLICCM-FYNNKTM 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129 221 WWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKsvrllsGSREKDRNLRRItRLVLVVVAVFVVCWTPIHIFILVEALG 300
Cdd:PHA03087 198 NWKLFINFEINIIGMLIPLTILLYCYSKILITLK------GINKSKKNKKAI-KLVLIIVILFVIFWLPFNVSVFVYSLH 270
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
gi 119607129 301 STSHSTA--ALSSYYF------CIALgyTNSSLNPILYAFLDENF 337
Cdd:PHA03087 271 ILHFKSGckAVKYIQYalhvteIISL--SHCCINPLIYAFVSEFF 313
PHA02638 PHA02638
CC chemokine receptor-like protein; Provisional
56-338 2.15e-31

CC chemokine receptor-like protein; Provisional


Pssm-ID: 165021 [Multi-domain]  Cd Length: 417  Bit Score: 122.81  E-value: 2.15e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  56 PAIPVIITAVYSVVFVVGLVGNSLVMfVIIRYTKMKTATNIYIFNLALADALVTTTMPFqsTVY-LMNSWPFGDVLCKiV 134
Cdd:PHA02638  95 PSISEYIKIFYIIIFILGLFGNAAII-MILFCKKIKTITDIYIFNLAISDLIFVIDFPF--IIYnEFDQWIFGDFMCK-V 170
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129 135 ISIDYY-NMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGI--------SAIVLGGTKVREDV 205
Cdd:PHA02638 171 ISASYYiGFFSNMFLITLMSIDRYFAILYPISFQKYRTFNIGIILCIISWILSLIITSpayfifeaSNIIFSAQDSNETI 250
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129 206 DVIECSL--QFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKSVRllsgsreKDRNLRRItRLVLVVVAVF 283
Cdd:PHA02638 251 SNYQCTLieDNEKNNISFLGRILQFEINILGMFIPIIIFAFCYIKIILKLKQLK-------KSKKTKSI-IIVSIIIICS 322
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 119607129 284 VVCWTPIHIFILVEALGSTsHSTAALSSYYFC--IALGY----------TNSSLNPILYAFLDENFK 338
Cdd:PHA02638 323 LICWIPLNIVILFATMYSF-KGFNSIISEHICgfIKLGYammlaeaislTHCCINPLIYTLIGENFR 388
PHA02834 PHA02834
chemokine receptor-like protein; Provisional
62-358 1.31e-27

chemokine receptor-like protein; Provisional


Pssm-ID: 165177 [Multi-domain]  Cd Length: 323  Bit Score: 110.38  E-value: 1.31e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  62 ITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTaTNIYIFNLALADALVTTTMPFQSTVYLmNSWPFGDVLCKIVISIDYYN 141
Cdd:PHA02834  31 VIVFYILLFIFGLIGNVLVIAVLIVKRFMFV-VDVYLFNIAMSDLMLVFSFPFIIHNDL-NEWIFGEFMCKLVLGVYFVG 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129 142 MFTSIFTLTMMSVDRYIAVCHPVKaldfrtpLKAKIINICIwLLSSSVGISAIVLGG-TKVREDVDVIECSLQFPDDDYS 220
Cdd:PHA02834 109 FFSNMFFVTLISIDRYILVVNATK-------IKNKSISLSV-LLSVAAWVCSVILSMpAMVLYYVDNTDNLKQCIFNDYH 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129 221 ---WWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKSVRllsgsrekDRNLRRITRLVLVVVAVFVVCWTPIHIFILVE 297
Cdd:PHA02834 181 enfSWSAFFNFEINIFGIVIPLIILIYCYSKILYTLKNCK--------NKNKTRSIKIILTVVTFTVVFWVPFNIVLFIN 252
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 119607129 298 ALGSTS-------HSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRD-FCFPLKMRMERQSTS 358
Cdd:PHA02834 253 SLQSVGlidigcyHFKKIVYSIDIAELISFVHCCVNPIIYAFVGKNFKKVFKNmFCRTNNIFIRQSSNN 321
PHA03235 PHA03235
DNA packaging protein UL33; Provisional
63-342 4.94e-05

DNA packaging protein UL33; Provisional


Pssm-ID: 223017 [Multi-domain]  Cd Length: 409  Bit Score: 43.65  E-value: 4.94e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129  63 TAVYSVVFVVGLVGNSLVMFVII---RYTKMKTATnIYIFNLALADALVTTTMPF--QSTVYLMNSWPFGdvlCKIViSI 137
Cdd:PHA03235  36 TFINLLIISVGGPLNLIVLVTQLlanRVHGFSTPT-LYMTNLYLANLLTVFVLPFimLSNQGLLSGSVAG---CKFA-SL 110
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129 138 DYYNMFTSIF-TLTMMSVDRYiAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVDVIE-----CS 211
Cdd:PHA03235 111 LYYASCTVGFaTVALIAADRY-RVIHQRTRARSSAYRSTYKILGLTWFASLICSGPAPVYTTVVAHDDVDPEApgyetCV 189
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119607129 212 LQFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKsvrlLSGSREKDRNLRRITrlvlVVVAVFVVCWTPIH 291
Cdd:PHA03235 190 IYFRADQVKTVLSTFKVLLTLVWGIAPVVMMTWFYTFFYRTLK----RASYKKRSRTLTFVC----ILLLSFLCLQTPFV 261
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 119607129 292 IFILVEALGSTS------HSTAALSSYYFCIALGYTNSSLNPILYAFLDENF----KRCFR 342
Cdd:PHA03235 262 AIMIFDSYATLIwpsdceHINLRDAVSTLSRLVPNLHCLLNPILYAFLGNDFlkrfRQCFR 322
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH