NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|118150528|ref|NP_001071227|]
View 

COP9 signalosome complex subunit 1 [Danio rerio]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
RPN7 pfam10602
26S proteasome subunit RPN7; RPN7 (known as the non ATPase regulatory subunit 6 in higher ...
123-305 5.44e-74

26S proteasome subunit RPN7; RPN7 (known as the non ATPase regulatory subunit 6 in higher eukaryotes) is one of the lid subunits of the 26S proteasome and has been shown in Saccharomyces cerevisiae to be required for structural integrity. The 26S proteasome is is involved in the ATP-dependent degradation of ubiquitinated proteins.


:

Pssm-ID: 256084  Cd Length: 174  Bit Score: 233.23  E-value: 5.44e-74
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528  123 DTAWAESTRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVI 202
Cdd:pfam10602   1 DEAWVEELRKKNEEELEELDAELKDAKENLGKEEIRRALLDLAEHYAKIGDLENALKAYSRAREYCTSLGHKIDMCLNLI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528  203 KVSVYLQNWSHVLSYVSKAESTPEIAEqrgerdsqNQAVLTKLKCAAGLAELASRKYKPAAKCFLQASFDhCDFPELLSP 282
Cdd:pfam10602  81 RVGIFFNDWDHVSKYIEKAKSLIEKGG--------DWERRNRLKVYEGLALLAIRDFKEAAKLFLDSLST-FTSTELISY 151
                         170       180
                  ....*....|....*....|...
gi 118150528  283 SNVAVYGGLCALATFDRQELQRN 305
Cdd:pfam10602 152 EDVAVYGVLCALASLDRVDLKKK 174
PCI pfam01399
PCI domain; This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and ...
320-424 2.11e-23

PCI domain; This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and TRIP-15).


:

Pssm-ID: 250589  Cd Length: 105  Bit Score: 94.61  E-value: 2.11e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528  320 PQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMNKMAVAFNTTVAALEDE 399
Cdd:pfam01399   1 PAYRDLLEAFYSGDLSEFEEILADHEEELLLDPGLAELLEDLRRKIRELNLRRLAKPYSSISLSDLAKLLGLSVDEVEKI 80
                          90       100
                  ....*....|....*....|....*
gi 118150528  400 LTQLILEGLINARIDSHSKILYARD 424
Cdd:pfam01399  81 LSKLIRDGRIRGKIDQVNGIVVFSK 105
 
Name Accession Description Interval E-value
RPN7 pfam10602
26S proteasome subunit RPN7; RPN7 (known as the non ATPase regulatory subunit 6 in higher ...
123-305 5.44e-74

26S proteasome subunit RPN7; RPN7 (known as the non ATPase regulatory subunit 6 in higher eukaryotes) is one of the lid subunits of the 26S proteasome and has been shown in Saccharomyces cerevisiae to be required for structural integrity. The 26S proteasome is is involved in the ATP-dependent degradation of ubiquitinated proteins.


Pssm-ID: 256084  Cd Length: 174  Bit Score: 233.23  E-value: 5.44e-74
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528  123 DTAWAESTRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVI 202
Cdd:pfam10602   1 DEAWVEELRKKNEEELEELDAELKDAKENLGKEEIRRALLDLAEHYAKIGDLENALKAYSRAREYCTSLGHKIDMCLNLI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528  203 KVSVYLQNWSHVLSYVSKAESTPEIAEqrgerdsqNQAVLTKLKCAAGLAELASRKYKPAAKCFLQASFDhCDFPELLSP 282
Cdd:pfam10602  81 RVGIFFNDWDHVSKYIEKAKSLIEKGG--------DWERRNRLKVYEGLALLAIRDFKEAAKLFLDSLST-FTSTELISY 151
                         170       180
                  ....*....|....*....|...
gi 118150528  283 SNVAVYGGLCALATFDRQELQRN 305
Cdd:pfam10602 152 EDVAVYGVLCALASLDRVDLKKK 174
PCI pfam01399
PCI domain; This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and ...
320-424 2.11e-23

PCI domain; This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and TRIP-15).


Pssm-ID: 250589  Cd Length: 105  Bit Score: 94.61  E-value: 2.11e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528  320 PQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMNKMAVAFNTTVAALEDE 399
Cdd:pfam01399   1 PAYRDLLEAFYSGDLSEFEEILADHEEELLLDPGLAELLEDLRRKIRELNLRRLAKPYSSISLSDLAKLLGLSVDEVEKI 80
                          90       100
                  ....*....|....*....|....*
gi 118150528  400 LTQLILEGLINARIDSHSKILYARD 424
Cdd:pfam01399  81 LSKLIRDGRIRGKIDQVNGIVVFSK 105
PAM smart00753
PCI/PINT associated module;
356-439 2.37e-16

PCI/PINT associated module;


Pssm-ID: 214803  Cd Length: 88  Bit Score: 74.59  E-value: 2.37e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528   356 PHVRTLYTQIRNRALIQYFSPYVSADMNKMAVAFNTTVAALEDELTQLILEGLINARIDSHSKILYARDVDQRS----TT 431
Cdd:smart00753   1 QLVERLQRKIRLTNLLQLSEPYSSISLSDLAKLLGLSVPEVEKLVSKAIRDGEISAKIDQVNGIVEFEEVDPRRseplAQ 80

                   ....*...
gi 118150528   432 FEKSLQMG 439
Cdd:smart00753  81 FAETLKKL 88
RPN7 COG5187
26S proteasome regulatory complex component, contains PCI domain [Posttranslational ...
163-462 2.68e-20

26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones]


Pssm-ID: 227514 [Multi-domain]  Cd Length: 412  Bit Score: 91.52  E-value: 2.68e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528 163 DLGDHYLDCGDLSNALKCYSRA--RDYCTSAKhvINMCLNVIKVSVYLQNWSHVLSYVSKAEStpeIAEQRGERDSQNqa 240
Cdd:COG5187  120 NIAEYYCQIMDIQNGFEWMRRLmrDAMSTGLK--IDVFLCKIRLGLIYGDRKVVEESLEVADD---IIEKGGDWERRN-- 192
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528 241 vltKLKCAAGLAELASRKYKPAAKCFLQ--ASFDHCdfpELLSPSNVAVYGGLCALATFDRQELQRNVISSSSFklfLEL 318
Cdd:COG5187  193 ---RYKVYKGIFKMMRRNFKEAAILLSDilPTFESS---ELISYSRAVRYAIFCGLLRLERRDIKTKILDSPEV---LDV 263
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528 319 EPQ------VRDIIFKFYESKYASCLKMLDEMKDNLLL-DMYLAPHVRTLYTQIRNRALIQYFSPYVSADMNKMAVAFNT 391
Cdd:COG5187  264 IGSseklgsLVQLATSLYECDYGGDFMNLLYLFCNSLQdDVFLGRHVDLFVREMRRRVYAQLLESYRLLSLESMAQTFGV 343
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 118150528 392 TVAALEDELTQLILEGLINARIDSHSKILYARDVDQRSTTFEKSLQMGKEFQRRAKAMIlrAAVLRNQIHV 462
Cdd:COG5187  344 SVEYVDRDLGEFIPEGRLNCVIDRVNGVVETNRPDEKNQQYSSVVKQGDDLLRKLQKYV--ATVMRGAFKV 412
 
Name Accession Description Interval E-value
RPN7 pfam10602
26S proteasome subunit RPN7; RPN7 (known as the non ATPase regulatory subunit 6 in higher ...
123-305 5.44e-74

26S proteasome subunit RPN7; RPN7 (known as the non ATPase regulatory subunit 6 in higher eukaryotes) is one of the lid subunits of the 26S proteasome and has been shown in Saccharomyces cerevisiae to be required for structural integrity. The 26S proteasome is is involved in the ATP-dependent degradation of ubiquitinated proteins.


Pssm-ID: 256084  Cd Length: 174  Bit Score: 233.23  E-value: 5.44e-74
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528  123 DTAWAESTRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVI 202
Cdd:pfam10602   1 DEAWVEELRKKNEEELEELDAELKDAKENLGKEEIRRALLDLAEHYAKIGDLENALKAYSRAREYCTSLGHKIDMCLNLI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528  203 KVSVYLQNWSHVLSYVSKAESTPEIAEqrgerdsqNQAVLTKLKCAAGLAELASRKYKPAAKCFLQASFDhCDFPELLSP 282
Cdd:pfam10602  81 RVGIFFNDWDHVSKYIEKAKSLIEKGG--------DWERRNRLKVYEGLALLAIRDFKEAAKLFLDSLST-FTSTELISY 151
                         170       180
                  ....*....|....*....|...
gi 118150528  283 SNVAVYGGLCALATFDRQELQRN 305
Cdd:pfam10602 152 EDVAVYGVLCALASLDRVDLKKK 174
PCI pfam01399
PCI domain; This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and ...
320-424 2.11e-23

PCI domain; This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and TRIP-15).


Pssm-ID: 250589  Cd Length: 105  Bit Score: 94.61  E-value: 2.11e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528  320 PQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMNKMAVAFNTTVAALEDE 399
Cdd:pfam01399   1 PAYRDLLEAFYSGDLSEFEEILADHEEELLLDPGLAELLEDLRRKIRELNLRRLAKPYSSISLSDLAKLLGLSVDEVEKI 80
                          90       100
                  ....*....|....*....|....*
gi 118150528  400 LTQLILEGLINARIDSHSKILYARD 424
Cdd:pfam01399  81 LSKLIRDGRIRGKIDQVNGIVVFSK 105
PAM smart00753
PCI/PINT associated module;
356-439 2.37e-16

PCI/PINT associated module;


Pssm-ID: 214803  Cd Length: 88  Bit Score: 74.59  E-value: 2.37e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528   356 PHVRTLYTQIRNRALIQYFSPYVSADMNKMAVAFNTTVAALEDELTQLILEGLINARIDSHSKILYARDVDQRS----TT 431
Cdd:smart00753   1 QLVERLQRKIRLTNLLQLSEPYSSISLSDLAKLLGLSVPEVEKLVSKAIRDGEISAKIDQVNGIVEFEEVDPRRseplAQ 80

                   ....*...
gi 118150528   432 FEKSLQMG 439
Cdd:smart00753  81 FAETLKKL 88
PINT smart00088
motif in proteasome subunits, Int-6, Nip-1 and TRIP-15; Also called the PCI (Proteasome, COP9, ...
356-439 2.37e-16

motif in proteasome subunits, Int-6, Nip-1 and TRIP-15; Also called the PCI (Proteasome, COP9, Initiation factor 3) domain. Unknown function.


Pssm-ID: 214509  Cd Length: 88  Bit Score: 74.59  E-value: 2.37e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528   356 PHVRTLYTQIRNRALIQYFSPYVSADMNKMAVAFNTTVAALEDELTQLILEGLINARIDSHSKILYARDVDQRS----TT 431
Cdd:smart00088   1 QLVERLQRKIRLTNLLQLSEPYSSISLSDLAKLLGLSVPEVEKLVSKAIRDGEISAKIDQVNGIVEFEEVDPRRseplAQ 80

                   ....*...
gi 118150528   432 FEKSLQMG 439
Cdd:smart00088  81 FAETLKKL 88
RPN7 COG5187
26S proteasome regulatory complex component, contains PCI domain [Posttranslational ...
163-462 2.68e-20

26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones]


Pssm-ID: 227514 [Multi-domain]  Cd Length: 412  Bit Score: 91.52  E-value: 2.68e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528 163 DLGDHYLDCGDLSNALKCYSRA--RDYCTSAKhvINMCLNVIKVSVYLQNWSHVLSYVSKAEStpeIAEQRGERDSQNqa 240
Cdd:COG5187  120 NIAEYYCQIMDIQNGFEWMRRLmrDAMSTGLK--IDVFLCKIRLGLIYGDRKVVEESLEVADD---IIEKGGDWERRN-- 192
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528 241 vltKLKCAAGLAELASRKYKPAAKCFLQ--ASFDHCdfpELLSPSNVAVYGGLCALATFDRQELQRNVISSSSFklfLEL 318
Cdd:COG5187  193 ---RYKVYKGIFKMMRRNFKEAAILLSDilPTFESS---ELISYSRAVRYAIFCGLLRLERRDIKTKILDSPEV---LDV 263
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528 319 EPQ------VRDIIFKFYESKYASCLKMLDEMKDNLLL-DMYLAPHVRTLYTQIRNRALIQYFSPYVSADMNKMAVAFNT 391
Cdd:COG5187  264 IGSseklgsLVQLATSLYECDYGGDFMNLLYLFCNSLQdDVFLGRHVDLFVREMRRRVYAQLLESYRLLSLESMAQTFGV 343
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 118150528 392 TVAALEDELTQLILEGLINARIDSHSKILYARDVDQRSTTFEKSLQMGKEFQRRAKAMIlrAAVLRNQIHV 462
Cdd:COG5187  344 SVEYVDRDLGEFIPEGRLNCVIDRVNGVVETNRPDEKNQQYSSVVKQGDDLLRKLQKYV--ATVMRGAFKV 412
RPN6 COG5159
26S proteasome regulatory complex component [Posttranslational modification, protein turnover, ...
339-456 5.63e-04

26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]


Pssm-ID: 227488 [Multi-domain]  Cd Length: 421  Bit Score: 40.67  E-value: 5.63e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150528 339 KMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMNKMAVAFNTTVAALEDELTQLILEGLINARIDSHSK 418
Cdd:COG5159  303 DALAQYSDELHQDSFIRSHLQYLYDVLLEKNLVKIIEPFSVVEISHIADVIGLDTNQVEGKLSQMILDKIFYGTLDQGDG 382
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 118150528 419 ILYARDVDQRSTTFEKSLQMGKEFQRRAKAMILRAAVL 456
Cdd:COG5159  383 CLIVYGEPAQDNTYDEALEQVEALDCVVDSLYEKASAL 420
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH