NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|117924836|ref|YP_865453|]
View 

metal dependent phosphohydrolase [Magnetococcus marinus MC-1]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
866-950 3.60e-09

Metal dependent phosphohydrolases with conserved 'HD' motif


:

Pssm-ID: 238032  Cd Length: 145  Bit Score: 56.19  E-value: 3.60e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  866 SNEERFKINEHVVQSILMLEKLPFPEGMKNVPEFAGA----HHETMIGTGYPRGLKKDQMSVQARIMAIADVFEALTAAD 941
Cdd:cd00077    50 TEEESELEKDHAIVGAEILRELLLEEVIKLIDELILAvdasHHERLDGLGYPDGLKGEEITLEARIVKLADRLDALRRDS 129

                  ....*....
gi 117924836  942 RPYKKPKKM 950
Cdd:cd00077   130 REKRRRIAE 138
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
440-612 2.38e-08

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


:

Pssm-ID: 214500  Cd Length: 149  Bit Score: 53.54  E-value: 2.38e-08
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836    440 DHEVLLEKILLGGIELTRADAGTLYMLEDDKLHFKILRtnslgmSMGGKsgqpvTLPPMNLHHPETgepnhSNVATYTAL 519
Cdd:smart00065    1 DLEELLQTILEELRQLLGADRVLIYLVDENDRGELVLV------AADGL-----TLPTLGIRFPLD-----EGLAGRVAE 64
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836    520 TAKTVNIVDAYDNTTFDfsgtrkFDAATGYRS-QSFLNVPLVpRGGKVLGVLQLLNAQDPvtgatVPFEADTVSIIEALS 598
Cdd:smart00065   65 TGRPLNIPDVEADPLFA------EDLLGRYQGvRSFLAVPLV-ADGELVGVLALHNKKSP-----RPFTEEDEELLQALA 132
                           170
                    ....*....|....
gi 117924836    599 AQAAVTLENKTLLE 612
Cdd:smart00065  133 NQLAIALANAQLYE 146
Cache_1 super family cl07034
Cache domain;
197-260 1.81e-03

Cache domain;


The actual alignment was detected with superfamily member pfam02743:

Pssm-ID: 271630  Cd Length: 80  Bit Score: 37.63  E-value: 1.81e-03
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 117924836   197 VTDAYVFNSSPELGITVSHALKGGA---GVVGVDLTLRQLNRLLQEKQISKHSHLLIFDQQKRVLAY 260
Cdd:pfam02743    1 VTEPYVDAATGDLVITIAQPVYDNGdllGVIGLDVPLEDLLKITKSIKLGKTGYAFIIDNNGKVLAH 67
COG2206 COG2206
c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]
620-977 8.86e-36

c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]


:

Pssm-ID: 225116 [Multi-domain]  Cd Length: 344  Bit Score: 139.55  E-value: 8.86e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  620 SFIRLMAGAIDAKSAYTGGHCERVPILGQRLADLANrATDGPFAGFTMNETQAEEMRVAAWLHDCGKVTTPEYVVDKATK 699
Cdd:COG2206    29 LFVDRLASALALAAAYLLSLEGTLLSSELLAEEPAA-AEEAFSALYAELSEEEEIRRAAAELYKVKAALVLNFEEIGEDI 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  700 LETTYNRIHEVRMRFEVLYRDAQIQFWQDVAQGNgmldaleksLKEKkaqldnDFEFLATSNVGGEYMApekqerirQIA 779
Cdd:COG2206   108 LIAKLDATLAVRIELSKVAREIVKKALVALARGD---------IKAK------DDYTYGHSVRVAELAE--------AIA 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  780 qipwmryfdDRLGLSEAELLRVK------DLEKVAIParesllsdraDHILprldrDKEvaelealgitmpvpenqynfg 853
Cdd:COG2206   165 ---------KKLGLSEEKIEELAlagllhDIGKIGIP----------DSIL-----NKP--------------------- 199
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  854 eiynlciakGTLSNEERFKINEHVVQSILMLEKLPFPegMKNVPEFAGAHHETMIGTGYPRGLKKDQMSVQARIMAIADV 933
Cdd:COG2206   200 ---------GKLTEEEFEIIKKHPIYGYDILKDLPEF--LESVRAVALRHHERWDGTGYPRGLKGEEIPLEARIIAVADV 268
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....
gi 117924836  934 FEALTaADRPYKKPKKMSEAIKIMsFMVKDQHIDKELFQLFLSS 977
Cdd:COG2206   269 YDALT-SDRPYKKAKSPEEALEEL-RKNSGGKFDPKVVDAFLKA 310
 
Name Accession Description Interval E-value
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
866-950 3.60e-09

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032  Cd Length: 145  Bit Score: 56.19  E-value: 3.60e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  866 SNEERFKINEHVVQSILMLEKLPFPEGMKNVPEFAGA----HHETMIGTGYPRGLKKDQMSVQARIMAIADVFEALTAAD 941
Cdd:cd00077    50 TEEESELEKDHAIVGAEILRELLLEEVIKLIDELILAvdasHHERLDGLGYPDGLKGEEITLEARIVKLADRLDALRRDS 129

                  ....*....
gi 117924836  942 RPYKKPKKM 950
Cdd:cd00077   130 REKRRRIAE 138
HD_5 pfam13487
HD domain; HD domains are metal dependent phosphohydrolases.
863-928 7.46e-20

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 257811  Cd Length: 63  Bit Score: 85.69  E-value: 7.46e-20
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 117924836   863 GTLSNEERFKINEHVVQSILMLEKLPFpegMKNVPEFAGAHHETMIGTGYPRGLKKDQMSVQARIM 928
Cdd:pfam13487    1 GTLTPEERAIINEHPEQTARLLEKIPR---LPPVAEIIGHHHERLDGSGYPRGLKGDEIPLGARIL 63
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
440-612 2.38e-08

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


Pssm-ID: 214500  Cd Length: 149  Bit Score: 53.54  E-value: 2.38e-08
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836    440 DHEVLLEKILLGGIELTRADAGTLYMLEDDKLHFKILRtnslgmSMGGKsgqpvTLPPMNLHHPETgepnhSNVATYTAL 519
Cdd:smart00065    1 DLEELLQTILEELRQLLGADRVLIYLVDENDRGELVLV------AADGL-----TLPTLGIRFPLD-----EGLAGRVAE 64
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836    520 TAKTVNIVDAYDNTTFDfsgtrkFDAATGYRS-QSFLNVPLVpRGGKVLGVLQLLNAQDPvtgatVPFEADTVSIIEALS 598
Cdd:smart00065   65 TGRPLNIPDVEADPLFA------EDLLGRYQGvRSFLAVPLV-ADGELVGVLALHNKKSP-----RPFTEEDEELLQALA 132
                           170
                    ....*....|....
gi 117924836    599 AQAAVTLENKTLLE 612
Cdd:smart00065  133 NQLAIALANAQLYE 146
GAF_2 pfam13185
GAF domain;
442-606 7.11e-08

GAF domain;


Pssm-ID: 257553  Cd Length: 150  Bit Score: 51.83  E-value: 7.11e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836   442 EVLLEKILLGGIELTRADAGTLYMLEDDKLHFKILRTnslgmsmGGKSGQPVTLPPMNLHHPETGEPNHSNVATYTALTA 521
Cdd:pfam13185    5 EELLEAILEALLELTGSEAGFIGLLDEDGTLLLLAAS-------GGTEELLRELAALSGELGGPPAAGAVGLGEGALRTG 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836   522 KTVNIVDAYDNTTFdfsgtRKFDAATGYRSQSFLNVPLVpRGGKVLGVLQLLNAQDpvtgatVPFEADTVSIIEALSAQA 601
Cdd:pfam13185   78 KPVIINDVASDPSG-----AGGLPAGHEGLRSFLSVPLI-SGGRVIGVLALGSKEP------GAFDEEDLELLELLAEQI 145

                   ....*
gi 117924836   602 AVTLE 606
Cdd:pfam13185  146 AIAIE 150
Cache_1 pfam02743
Cache domain;
197-260 1.81e-03

Cache domain;


Pssm-ID: 251508  Cd Length: 80  Bit Score: 37.63  E-value: 1.81e-03
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 117924836   197 VTDAYVFNSSPELGITVSHALKGGA---GVVGVDLTLRQLNRLLQEKQISKHSHLLIFDQQKRVLAY 260
Cdd:pfam02743    1 VTEPYVDAATGDLVITIAQPVYDNGdllGVIGLDVPLEDLLKITKSIKLGKTGYAFIIDNNGKVLAH 67
FhlA COG2203
FOG: GAF domain [Signal transduction mechanisms]
552-616 2.52e-03

FOG: GAF domain [Signal transduction mechanisms]


Pssm-ID: 225113  Cd Length: 175  Bit Score: 38.80  E-value: 2.52e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 117924836  552 QSFLNVPLVpRGGKVLGVLQLLNAQDPVtgatvPFEADTVSIIEALSAQAAVTLENKTLLEAQKA 616
Cdd:COG2203   115 RSYLGVPLI-AQGELLGLLCVHDSEPRR-----QWSEEELELLEELAEQVAIAIERARLYEELQE 173
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic ...
860-946 4.70e-03

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679  Cd Length: 124  Bit Score: 36.89  E-value: 4.70e-03
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836    860 IAKGTLSNEERFKINE---HVVQSILMLEKLPFPEGMKNVPEFAGAHHETMIGtgyprGLKKDQMSVQARIMAIADVFEA 936
Cdd:smart00471   40 IGKPGTPDSFLVKTSVledHHFIGAEILLEEEEPRILEEILRTAILSHHERPD-----GLRGEPITLEARIVKVADRLDA 114
                            90
                    ....*....|
gi 117924836    937 LTaADRPYKK 946
Cdd:smart00471  115 LR-ADRRYRR 123
COG2206 COG2206
c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]
620-977 8.86e-36

c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]


Pssm-ID: 225116 [Multi-domain]  Cd Length: 344  Bit Score: 139.55  E-value: 8.86e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  620 SFIRLMAGAIDAKSAYTGGHCERVPILGQRLADLANrATDGPFAGFTMNETQAEEMRVAAWLHDCGKVTTPEYVVDKATK 699
Cdd:COG2206    29 LFVDRLASALALAAAYLLSLEGTLLSSELLAEEPAA-AEEAFSALYAELSEEEEIRRAAAELYKVKAALVLNFEEIGEDI 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  700 LETTYNRIHEVRMRFEVLYRDAQIQFWQDVAQGNgmldaleksLKEKkaqldnDFEFLATSNVGGEYMApekqerirQIA 779
Cdd:COG2206   108 LIAKLDATLAVRIELSKVAREIVKKALVALARGD---------IKAK------DDYTYGHSVRVAELAE--------AIA 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  780 qipwmryfdDRLGLSEAELLRVK------DLEKVAIParesllsdraDHILprldrDKEvaelealgitmpvpenqynfg 853
Cdd:COG2206   165 ---------KKLGLSEEKIEELAlagllhDIGKIGIP----------DSIL-----NKP--------------------- 199
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  854 eiynlciakGTLSNEERFKINEHVVQSILMLEKLPFPegMKNVPEFAGAHHETMIGTGYPRGLKKDQMSVQARIMAIADV 933
Cdd:COG2206   200 ---------GKLTEEEFEIIKKHPIYGYDILKDLPEF--LESVRAVALRHHERWDGTGYPRGLKGEEIPLEARIIAVADV 268
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....
gi 117924836  934 FEALTaADRPYKKPKKMSEAIKIMsFMVKDQHIDKELFQLFLSS 977
Cdd:COG2206   269 YDALT-SDRPYKKAKSPEEALEEL-RKNSGGKFDPKVVDAFLKA 310
 
Name Accession Description Interval E-value
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
866-950 3.60e-09

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032  Cd Length: 145  Bit Score: 56.19  E-value: 3.60e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  866 SNEERFKINEHVVQSILMLEKLPFPEGMKNVPEFAGA----HHETMIGTGYPRGLKKDQMSVQARIMAIADVFEALTAAD 941
Cdd:cd00077    50 TEEESELEKDHAIVGAEILRELLLEEVIKLIDELILAvdasHHERLDGLGYPDGLKGEEITLEARIVKLADRLDALRRDS 129

                  ....*....
gi 117924836  942 RPYKKPKKM 950
Cdd:cd00077   130 REKRRRIAE 138
HD_5 pfam13487
HD domain; HD domains are metal dependent phosphohydrolases.
863-928 7.46e-20

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 257811  Cd Length: 63  Bit Score: 85.69  E-value: 7.46e-20
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 117924836   863 GTLSNEERFKINEHVVQSILMLEKLPFpegMKNVPEFAGAHHETMIGTGYPRGLKKDQMSVQARIM 928
Cdd:pfam13487    1 GTLTPEERAIINEHPEQTARLLEKIPR---LPPVAEIIGHHHERLDGSGYPRGLKGDEIPLGARIL 63
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
440-612 2.38e-08

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


Pssm-ID: 214500  Cd Length: 149  Bit Score: 53.54  E-value: 2.38e-08
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836    440 DHEVLLEKILLGGIELTRADAGTLYMLEDDKLHFKILRtnslgmSMGGKsgqpvTLPPMNLHHPETgepnhSNVATYTAL 519
Cdd:smart00065    1 DLEELLQTILEELRQLLGADRVLIYLVDENDRGELVLV------AADGL-----TLPTLGIRFPLD-----EGLAGRVAE 64
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836    520 TAKTVNIVDAYDNTTFDfsgtrkFDAATGYRS-QSFLNVPLVpRGGKVLGVLQLLNAQDPvtgatVPFEADTVSIIEALS 598
Cdd:smart00065   65 TGRPLNIPDVEADPLFA------EDLLGRYQGvRSFLAVPLV-ADGELVGVLALHNKKSP-----RPFTEEDEELLQALA 132
                           170
                    ....*....|....
gi 117924836    599 AQAAVTLENKTLLE 612
Cdd:smart00065  133 NQLAIALANAQLYE 146
GAF_2 pfam13185
GAF domain;
442-606 7.11e-08

GAF domain;


Pssm-ID: 257553  Cd Length: 150  Bit Score: 51.83  E-value: 7.11e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836   442 EVLLEKILLGGIELTRADAGTLYMLEDDKLHFKILRTnslgmsmGGKSGQPVTLPPMNLHHPETGEPNHSNVATYTALTA 521
Cdd:pfam13185    5 EELLEAILEALLELTGSEAGFIGLLDEDGTLLLLAAS-------GGTEELLRELAALSGELGGPPAAGAVGLGEGALRTG 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836   522 KTVNIVDAYDNTTFdfsgtRKFDAATGYRSQSFLNVPLVpRGGKVLGVLQLLNAQDpvtgatVPFEADTVSIIEALSAQA 601
Cdd:pfam13185   78 KPVIINDVASDPSG-----AGGLPAGHEGLRSFLSVPLI-SGGRVIGVLALGSKEP------GAFDEEDLELLELLAEQI 145

                   ....*
gi 117924836   602 AVTLE 606
Cdd:pfam13185  146 AIAIE 150
GAF pfam01590
GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl ...
440-605 1.02e-06

GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl cyclases, phytochromes, FhlA and NifA. Adenylyl and guanylyl cyclases catalyse ATP and GTP to the second messengers cAMP and cGMP, respectively, these products up-regulating catalytic activity by binding to the regulatory GAF domain(s). The opposite hydrolysis reaction is catalysed by phosphodiesterase. cGMP-dependent 3',5'-cyclic phosphodiesterase catalyses the conversion of guanosine 3',5'-cyclic phosphate to guanosine 5'-phosphate. Here too, cGMP regulates catalytic activity by GAF-domain binding. Phytochromes are regulatory photoreceptors in plants and bacteria which exist in two thermally-stable states that are reversibly inter-convertible by light: the Pr state absorbs maximally in the red region of the spectrum, while the Pfr state absorbs maximally in the far-red region. This domain is also found in FhlA (formate hydrogen lyase transcriptional activator) and NifA, a transcriptional activator which is required for activation of most Nif operons which are directly involved in nitrogen fixation. NifA interacts with sigma-54.


Pssm-ID: 250726  Cd Length: 146  Bit Score: 48.35  E-value: 1.02e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836   440 DHEVLLEKILLGGIELTRADAGTLYMLEDDKLhfkilrtnslgmsmggksgqpvtLPPMNLHHPETGEPNHSN------- 512
Cdd:pfam01590    1 DLEELLQTILEELRELLGADRVAIYLADADGL-----------------------LLYLVAGDGLSDIPLAARglplggg 57
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836   513 VATYTALTAKTVNIVDAYDNTTFDF---SGTRKFDAATGYRSQSFLNVPLVpRGGKVLGVLQLLNAQDPvtgatvPFEAD 589
Cdd:pfam01590   58 VVGEVIAGGNPIVVPDVQDDPRFRDltaLASDLPHFLRGLGIRSCLAVPLK-GGGELIGVLVLHSTSPR------AFTEE 130
                          170
                   ....*....|....*.
gi 117924836   590 TVSIIEALSAQAAVTL 605
Cdd:pfam01590  131 ELELLQALADQVAIAL 146
GAF_3 pfam13492
GAF domain;
440-607 8.66e-05

GAF domain;


Pssm-ID: 257816  Cd Length: 129  Bit Score: 42.05  E-value: 8.66e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836   440 DHEVLLEKILLGGIELTRADAGTLYMLEDDKLHFKILRtnslgmsmgGKSGQPVTLPPMnlhhpetgePNHSNVATYTAL 519
Cdd:pfam13492    1 DPDELLERALELLAELLGADRAALYLLDEDGLELRLVA---------GSGGEPRLSESL---------PEDSPLAQRALE 62
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836   520 TAKTVNIVDaydnttfdfsgtrkFDAATGYRSQSFLNVPLVpRGGKVLGVLQLLNAQDpvtgatVPFEADTVSIIEALSA 599
Cdd:pfam13492   63 KGEPVSVPA--------------GDNRDLLPSESLLAVPLR-AGGEVIGVLVLESTPE------EAFTPEDLELLELLAS 121

                   ....*...
gi 117924836   600 QAAVTLEN 607
Cdd:pfam13492  122 QIAIALEN 129
Cache_1 pfam02743
Cache domain;
197-260 1.81e-03

Cache domain;


Pssm-ID: 251508  Cd Length: 80  Bit Score: 37.63  E-value: 1.81e-03
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 117924836   197 VTDAYVFNSSPELGITVSHALKGGA---GVVGVDLTLRQLNRLLQEKQISKHSHLLIFDQQKRVLAY 260
Cdd:pfam02743    1 VTEPYVDAATGDLVITIAQPVYDNGdllGVIGLDVPLEDLLKITKSIKLGKTGYAFIIDNNGKVLAH 67
HD pfam01966
HD domain; HD domains are metal dependent phosphohydrolases.
860-937 2.10e-03

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 251000  Cd Length: 110  Bit Score: 37.60  E-value: 2.10e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836   860 IAKGTLS---NEERFKINEHVVQSILMLEKLPFPEGMKNVPEFAGAHHETMIgtgyprGLKKDQMSVQARIMAIADVFEA 936
Cdd:pfam01966   36 IGKPPFGdekPLLFEIFLGHAVVGAEILRELEKPLGLEDVLKLILEHHESWE------GLYGEPISLEARIVKLADRLDA 109

                   .
gi 117924836   937 L 937
Cdd:pfam01966  110 L 110
FhlA COG2203
FOG: GAF domain [Signal transduction mechanisms]
552-616 2.52e-03

FOG: GAF domain [Signal transduction mechanisms]


Pssm-ID: 225113  Cd Length: 175  Bit Score: 38.80  E-value: 2.52e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 117924836  552 QSFLNVPLVpRGGKVLGVLQLLNAQDPVtgatvPFEADTVSIIEALSAQAAVTLENKTLLEAQKA 616
Cdd:COG2203   115 RSYLGVPLI-AQGELLGLLCVHDSEPRR-----QWSEEELELLEELAEQVAIAIERARLYEELQE 173
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic ...
860-946 4.70e-03

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679  Cd Length: 124  Bit Score: 36.89  E-value: 4.70e-03
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836    860 IAKGTLSNEERFKINE---HVVQSILMLEKLPFPEGMKNVPEFAGAHHETMIGtgyprGLKKDQMSVQARIMAIADVFEA 936
Cdd:smart00471   40 IGKPGTPDSFLVKTSVledHHFIGAEILLEEEEPRILEEILRTAILSHHERPD-----GLRGEPITLEARIVKVADRLDA 114
                            90
                    ....*....|
gi 117924836    937 LTaADRPYKK 946
Cdd:smart00471  115 LR-ADRRYRR 123
COG2206 COG2206
c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]
620-977 8.86e-36

c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]


Pssm-ID: 225116 [Multi-domain]  Cd Length: 344  Bit Score: 139.55  E-value: 8.86e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  620 SFIRLMAGAIDAKSAYTGGHCERVPILGQRLADLANrATDGPFAGFTMNETQAEEMRVAAWLHDCGKVTTPEYVVDKATK 699
Cdd:COG2206    29 LFVDRLASALALAAAYLLSLEGTLLSSELLAEEPAA-AEEAFSALYAELSEEEEIRRAAAELYKVKAALVLNFEEIGEDI 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  700 LETTYNRIHEVRMRFEVLYRDAQIQFWQDVAQGNgmldaleksLKEKkaqldnDFEFLATSNVGGEYMApekqerirQIA 779
Cdd:COG2206   108 LIAKLDATLAVRIELSKVAREIVKKALVALARGD---------IKAK------DDYTYGHSVRVAELAE--------AIA 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  780 qipwmryfdDRLGLSEAELLRVK------DLEKVAIParesllsdraDHILprldrDKEvaelealgitmpvpenqynfg 853
Cdd:COG2206   165 ---------KKLGLSEEKIEELAlagllhDIGKIGIP----------DSIL-----NKP--------------------- 199
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  854 eiynlciakGTLSNEERFKINEHVVQSILMLEKLPFPegMKNVPEFAGAHHETMIGTGYPRGLKKDQMSVQARIMAIADV 933
Cdd:COG2206   200 ---------GKLTEEEFEIIKKHPIYGYDILKDLPEF--LESVRAVALRHHERWDGTGYPRGLKGEEIPLEARIIAVADV 268
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....
gi 117924836  934 FEALTaADRPYKKPKKMSEAIKIMsFMVKDQHIDKELFQLFLSS 977
Cdd:COG2206   269 YDALT-SDRPYKKAKSPEEALEEL-RKNSGGKFDPKVVDAFLKA 310
COG3437 COG3437
Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription ...
735-975 1.02e-15

Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms]


Pssm-ID: 225971 [Multi-domain]  Cd Length: 360  Bit Score: 78.55  E-value: 1.02e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  735 MLDALEKSLKEKKAQ--------LDNDFEFLATSnvgGEYMAPEKQERIRQIAQIpwMRYFDDRLGLSEAELLRVK---- 802
Cdd:COG3437   145 QNLYLELQELRRRTEelaqiednLDETLEELAAL---LEVRDYETGDHLERVAQY--SELLAELLGLSEEEVDLIKkaap 219
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  803 --DLEKVAIParesllsdraDHILprldrdkevaelealgitmpvpenqynfgeiynlcIAKGTLSNEERFKINEHVVQS 880
Cdd:COG3437   220 lhDIGKVAIP----------DSIL-----------------------------------LKPGKLTSEEFEIMKGHPILG 254
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117924836  881 ILMLEKLPfpEGMKNVPEFAGAHHETMIGTGYPRGLKKDQMSVQARIMAIADVFEALTaADRPYKKPKKMSEAIKIMSfM 960
Cdd:COG3437   255 AEILKSSE--RLMQVAAEIARHHHERWDGSGYPDGLKGDEIPLSARIVAIADVFDALV-SGRPYKEAMSTEEALEIIR-A 330
                         250
                  ....*....|....*
gi 117924836  961 VKDQHIDKELFQLFL 975
Cdd:COG3437   331 QSGRLFDPKLVEAFI 345
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH