NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|117923515|ref|YP_864132|]
View 

metal dependent phosphohydrolase [Magnetococcus marinus MC-1]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
172-312 1.54e-09

Metal dependent phosphohydrolases with conserved 'HD' motif


:

Pssm-ID: 238032  Cd Length: 145  Bit Score: 55.81  E-value: 1.54e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515 172 EPTVVHGVETALLCVELAKGLQWPKERLIQAGLAGMLHDVGKAAVSKEILSHQGPLTDLqrqeverHALIGYLMLSN--N 249
Cdd:cd00077    1 EHRFEHSLRVAQLARRLAEELGLSEEDIELLRLAALLHDIGKPGTPDAITEEESELEKD-------HAIVGAEILREllL 73
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 117923515 250 EQLHDLPAFCAGAHHESFQSGMPGYGIlsdfselqgdPRQRYTPQEQALAQLVCIADVYSALR 312
Cdd:cd00077   74 EEVIKLIDELILAVDASHHERLDGLGY----------PDGLKGEEITLEARIVKLADRLDALR 126
 
Name Accession Description Interval E-value
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
172-312 1.54e-09

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032  Cd Length: 145  Bit Score: 55.81  E-value: 1.54e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515 172 EPTVVHGVETALLCVELAKGLQWPKERLIQAGLAGMLHDVGKAAVSKEILSHQGPLTDLqrqeverHALIGYLMLSN--N 249
Cdd:cd00077    1 EHRFEHSLRVAQLARRLAEELGLSEEDIELLRLAALLHDIGKPGTPDAITEEESELEKD-------HAIVGAEILREllL 73
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 117923515 250 EQLHDLPAFCAGAHHESFQSGMPGYGIlsdfselqgdPRQRYTPQEQALAQLVCIADVYSALR 312
Cdd:cd00077   74 EEVIKLIDELILAVDASHHERLDGLGY----------PDGLKGEEITLEARIVKLADRLDALR 126
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic ...
170-312 6.55e-08

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679  Cd Length: 124  Bit Score: 50.76  E-value: 6.55e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515   170 HDEPTVVHGVETALLCVELAKGLQWPKERLIQagLAGMLHDVGKAAVSKEILshqgpltdLQRQEVERHALIGYLMLSNN 249
Cdd:smart00471   1 SDYHVFEHSLRVAQLAAALAEELGLLDIELLL--LAALLHDIGKPGTPDSFL--------VKTSVLEDHHFIGAEILLEE 70
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 117923515   250 EqlhdlpafcagahHESFQSGMPGYGILSDFSELQGDPRQRYTPqeqaLAQLVCIADVYSALR 312
Cdd:smart00471  71 E-------------EPRILEEILRTAILSHHERPDGLRGEPITL----EARIVKVADRLDALR 116
HD pfam01966
HD domain; HD domains are metal dependent phosphohydrolases.
177-311 2.03e-06

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 251000  Cd Length: 110  Bit Score: 46.07  E-value: 2.03e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515  177 HGVETALLCVELAKGLQWPKERLIQagLAGMLHDVGKAAVSKEILSHQGPLtdlqrqevERHALIGYLMLSNNEQLHDLP 256
Cdd:pfam01966   4 HSLRVALLARELAEELGELDRELLL--LAALLHDIGKPPFGDEKPLLFEIF--------LGHAVVGAEILRELEKPLGLE 73
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 117923515  257 AFC--AGAHHESFqsgmpgygilsdfselqgdpRQRYTPQEQALAQLVCIADVYSAL 311
Cdd:pfam01966  74 DVLklILEHHESW--------------------EGLYGEPISLEARIVKLADRLDAL 110
COG2206 COG2206
c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]
145-346 2.87e-25

c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]


Pssm-ID: 225116 [Multi-domain]  Cd Length: 344  Bit Score: 105.65  E-value: 2.87e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515 145 IGSLLEEIMDHYTEFAAESikELSEHDEPTVVHGVETALLCVELAKGLQWPKERLIQAGLAGMLHDVGKAAVSKEILSHQ 224
Cdd:COG2206  122 LSKVAREIVKKALVALARG--DIKAKDDYTYGHSVRVAELAEAIAKKLGLSEEKIEELALAGLLHDIGKIGIPDSILNKP 199
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515 225 GPLTDLQRQEVERHALIGYLMLSNNEQLHDLPAFCAGAHHESFQ-SGMPgYGilsdfseLQGDPrqryTPQEqalAQLVC 303
Cdd:COG2206  200 GKLTEEEFEIIKKHPIYGYDILKDLPEFLESVRAVALRHHERWDgTGYP-RG-------LKGEE----IPLE---ARIIA 264
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 117923515 304 IADVYSALRQGYTLKGPVSPLETLIEMNRMAAsGRFNPEFYRV 346
Cdd:COG2206  265 VADVYDALTSDRPYKKAKSPEEALEELRKNSG-GKFDPKVVDA 306
RNase_Y TIGR03319
ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from ...
177-314 2.72e-03

ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from Bacillus subtilis, YmdA, has been shown to be involved in turnover of yitJ riboswitch [Transcription, Degradation of RNA].


Pssm-ID: 188306 [Multi-domain]  Cd Length: 514  Bit Score: 38.75  E-value: 2.72e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515  177 HGVETALLCVELAKGLqwpKERLIQAGLAGMLHDVGKAavskeiLSHqgpltdlqrqEVER-HALIGYLMLSN-NEqlHD 254
Cdd:TIGR03319 333 HSIEVAHLAGIMAAEL---GEDVKLAKRAGLLHDIGKA------VDH----------EVEGsHVEIGAELAKKyKE--SP 391
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515  255 LPAFCAGAHHesfqsgmpgygilsdfselqGDprqryTPQEQALAQLVCIADVYSALRQG 314
Cdd:TIGR03319 392 EVVNAIAAHH--------------------GD-----VEPTSIEAVLVAAADALSAARPG 426
PRK12704 PRK12704
phosphodiesterase; Provisional
177-314 6.71e-03

phosphodiesterase; Provisional


Pssm-ID: 237177 [Multi-domain]  Cd Length: 520  Bit Score: 37.45  E-value: 6.71e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515 177 HGVETALLCVELAKGLqwpKERLIQAGLAGMLHDVGKAavskeiLSHqgpltdlqrqEVER-HALIGYLMLsnnEQLHDL 255
Cdd:PRK12704 339 HSIEVAHLAGLMAAEL---GLDVKLAKRAGLLHDIGKA------LDH----------EVEGsHVEIGAELA---KKYKES 396
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 117923515 256 PAFC--AGAHHesfqsgmpgygilsdfselqGDprqryTPQEQALAQLVCIADVYSALRQG 314
Cdd:PRK12704 397 PVVInaIAAHH--------------------GD-----EEPTSIEAVLVAAADAISAARPG 432
 
Name Accession Description Interval E-value
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
172-312 1.54e-09

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032  Cd Length: 145  Bit Score: 55.81  E-value: 1.54e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515 172 EPTVVHGVETALLCVELAKGLQWPKERLIQAGLAGMLHDVGKAAVSKEILSHQGPLTDLqrqeverHALIGYLMLSN--N 249
Cdd:cd00077    1 EHRFEHSLRVAQLARRLAEELGLSEEDIELLRLAALLHDIGKPGTPDAITEEESELEKD-------HAIVGAEILREllL 73
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 117923515 250 EQLHDLPAFCAGAHHESFQSGMPGYGIlsdfselqgdPRQRYTPQEQALAQLVCIADVYSALR 312
Cdd:cd00077   74 EEVIKLIDELILAVDASHHERLDGLGY----------PDGLKGEEITLEARIVKLADRLDALR 126
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic ...
170-312 6.55e-08

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679  Cd Length: 124  Bit Score: 50.76  E-value: 6.55e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515   170 HDEPTVVHGVETALLCVELAKGLQWPKERLIQagLAGMLHDVGKAAVSKEILshqgpltdLQRQEVERHALIGYLMLSNN 249
Cdd:smart00471   1 SDYHVFEHSLRVAQLAAALAEELGLLDIELLL--LAALLHDIGKPGTPDSFL--------VKTSVLEDHHFIGAEILLEE 70
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 117923515   250 EqlhdlpafcagahHESFQSGMPGYGILSDFSELQGDPRQRYTPqeqaLAQLVCIADVYSALR 312
Cdd:smart00471  71 E-------------EPRILEEILRTAILSHHERPDGLRGEPITL----EARIVKVADRLDALR 116
HD pfam01966
HD domain; HD domains are metal dependent phosphohydrolases.
177-311 2.03e-06

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 251000  Cd Length: 110  Bit Score: 46.07  E-value: 2.03e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515  177 HGVETALLCVELAKGLQWPKERLIQagLAGMLHDVGKAAVSKEILSHQGPLtdlqrqevERHALIGYLMLSNNEQLHDLP 256
Cdd:pfam01966   4 HSLRVALLARELAEELGELDRELLL--LAALLHDIGKPPFGDEKPLLFEIF--------LGHAVVGAEILRELEKPLGLE 73
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 117923515  257 AFC--AGAHHESFqsgmpgygilsdfselqgdpRQRYTPQEQALAQLVCIADVYSAL 311
Cdd:pfam01966  74 DVLklILEHHESW--------------------EGLYGEPISLEARIVKLADRLDAL 110
HDOD pfam08668
HDOD domain;
177-246 9.21e-03

HDOD domain;


Pssm-ID: 254961  Cd Length: 196  Bit Score: 36.06  E-value: 9.21e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515  177 HGVETALLCVELAKGLqwPKERLIQAGLAGMLHDVGK-----------AAVSKEILSHQGPLTDLQRQEVER-HALIGYL 244
Cdd:pfam08668  98 HSLACALAARLLARRL--GLDDPEEAFTAGLLHDIGKlillsllpdeyEEILERVAAEGISLLEAERELLGTdHAEVGAA 175

                  ..
gi 117923515  245 ML 246
Cdd:pfam08668 176 LL 177
COG2206 COG2206
c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]
145-346 2.87e-25

c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]


Pssm-ID: 225116 [Multi-domain]  Cd Length: 344  Bit Score: 105.65  E-value: 2.87e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515 145 IGSLLEEIMDHYTEFAAESikELSEHDEPTVVHGVETALLCVELAKGLQWPKERLIQAGLAGMLHDVGKAAVSKEILSHQ 224
Cdd:COG2206  122 LSKVAREIVKKALVALARG--DIKAKDDYTYGHSVRVAELAEAIAKKLGLSEEKIEELALAGLLHDIGKIGIPDSILNKP 199
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515 225 GPLTDLQRQEVERHALIGYLMLSNNEQLHDLPAFCAGAHHESFQ-SGMPgYGilsdfseLQGDPrqryTPQEqalAQLVC 303
Cdd:COG2206  200 GKLTEEEFEIIKKHPIYGYDILKDLPEFLESVRAVALRHHERWDgTGYP-RG-------LKGEE----IPLE---ARIIA 264
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 117923515 304 IADVYSALRQGYTLKGPVSPLETLIEMNRMAAsGRFNPEFYRV 346
Cdd:COG2206  265 VADVYDALTSDRPYKKAKSPEEALEELRKNSG-GKFDPKVVDA 306
COG3437 COG3437
Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription ...
48-360 6.65e-13

Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms]


Pssm-ID: 225971 [Multi-domain]  Cd Length: 360  Bit Score: 68.92  E-value: 6.65e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515  48 HAKLVLTRDVvldGITYLTAGSDLESRtiVRLLNLGIDQVYAQP-RIAERIKQCASRLDAMFDATRAVIFAEGVKStrda 126
Cdd:COG3437   81 KAMSPSTRRI---PVILLTAYADSEDR--QRALEAGADDYLSKPiSPKELVARVSSHLQLKRNEDFLLDQNLYLEL---- 151
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515 127 LELLKRKGRLDlqpfkeQIGSLLEEIMdhytefaaESIKELSEH-DEPTVVHGVETALLCVELAK--GLQWPKERLIQag 203
Cdd:COG3437  152 QELRRRTEELA------QIEDNLDETL--------EELAALLEVrDYETGDHLERVAQYSELLAEllGLSEEEVDLIK-- 215
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515 204 LAGMLHDVGKAAVSKEILSHQGPLTDLQRQEVERHALIGYLMLSNNEQLHDLPAFCAGAHHESFQ-SGMPgYGilsdfse 282
Cdd:COG3437  216 KAAPLHDIGKVAIPDSILLKPGKLTSEEFEIMKGHPILGAEILKSSERLMQVAAEIARHHHERWDgSGYP-DG------- 287
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515 283 LQGDprqrytpQEQALAQLVCIADVYSALRQGYTLKGPVSPLETLIEMnrMAASGR-FNPE----FYRVWyTTFKRQHRL 357
Cdd:COG3437  288 LKGD-------EIPLSARIVAIADVFDALVSGRPYKEAMSTEEALEII--RAQSGRlFDPKlveaFIQVE-DEIIDIARR 357

                 ...
gi 117923515 358 LLQ 360
Cdd:COG3437  358 FAD 360
RNase_Y TIGR03319
ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from ...
177-314 2.72e-03

ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from Bacillus subtilis, YmdA, has been shown to be involved in turnover of yitJ riboswitch [Transcription, Degradation of RNA].


Pssm-ID: 188306 [Multi-domain]  Cd Length: 514  Bit Score: 38.75  E-value: 2.72e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515  177 HGVETALLCVELAKGLqwpKERLIQAGLAGMLHDVGKAavskeiLSHqgpltdlqrqEVER-HALIGYLMLSN-NEqlHD 254
Cdd:TIGR03319 333 HSIEVAHLAGIMAAEL---GEDVKLAKRAGLLHDIGKA------VDH----------EVEGsHVEIGAELAKKyKE--SP 391
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515  255 LPAFCAGAHHesfqsgmpgygilsdfselqGDprqryTPQEQALAQLVCIADVYSALRQG 314
Cdd:TIGR03319 392 EVVNAIAAHH--------------------GD-----VEPTSIEAVLVAAADALSAARPG 426
PRK12704 PRK12704
phosphodiesterase; Provisional
177-314 6.71e-03

phosphodiesterase; Provisional


Pssm-ID: 237177 [Multi-domain]  Cd Length: 520  Bit Score: 37.45  E-value: 6.71e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117923515 177 HGVETALLCVELAKGLqwpKERLIQAGLAGMLHDVGKAavskeiLSHqgpltdlqrqEVER-HALIGYLMLsnnEQLHDL 255
Cdd:PRK12704 339 HSIEVAHLAGLMAAEL---GLDVKLAKRAGLLHDIGKA------LDH----------EVEGsHVEIGAELA---KKYKES 396
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 117923515 256 PAFC--AGAHHesfqsgmpgygilsdfselqGDprqryTPQEQALAQLVCIADVYSALRQG 314
Cdd:PRK12704 397 PVVInaIAAHH--------------------GD-----EEPTSIEAVLVAAADAISAARPG 432
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH