NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|116251086|ref|YP_766924|]
View 

methyl-accepting chemotaxis protein [Rhizobium leguminosarum bv. viciae 3841]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
499-698 1.91e-60

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


:

Pssm-ID: 206779  Cd Length: 200  Bit Score: 203.62  E-value: 1.91e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 499 EQQAASVEETAAALEQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVDAMTGIEQSSQSISNIIGVIDDIAFQT 578
Cdd:cd11386    1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 579 NLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSATAAKEIKALITSSGDQVKRGVDLVGQTGKALQAIVAEVQQINSN 658
Cdd:cd11386   81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 116251086 659 VQAVVQAAREQSTGLLEINTAVNQMDQSTQKNAAMVEESN 698
Cdd:cd11386  161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Cache_1 super family cl07034
Cache domain;
172-252 4.81e-12

Cache domain;


The actual alignment was detected with superfamily member pfam02743:

Pssm-ID: 271630  Cd Length: 80  Bit Score: 63.05  E-value: 4.81e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  172 VIEPYVYAVDGKdvLMTSVAKPIMVDGKALGVAGMDISLDDANKAISAVHPMETGYLSLVTGAGSIISHPSAELAGKNIK 251
Cdd:pfam02743   1 VTEPYVDAATGD--LVITIAQPVYDNGDLLGVIGLDVPLEDLLKITKSIKLGKTGYAFIIDNNGKVLAHPNHEPVTKLLG 78

                  .
gi 116251086  252 D 252
Cdd:pfam02743  79 D 79
HAMP pfam00672
HAMP domain;
319-388 2.00e-07

HAMP domain;


:

Pssm-ID: 250044  Cd Length: 70  Bit Score: 49.15  E-value: 2.00e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  319 VAITAIAALLLGLSGWLIARKFIRRIEGVIAETDRIAHGQLDVQLSDKnAKDEIGDLSRSLAILLESNRQ 388
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVS-GPDEIGELARAFNQMADRLRE 70
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
473-718 1.57e-78

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


:

Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 255.67  E-value: 1.57e-78
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   473 FSENAAVIQAGSEEIRSGADDLARRTEQQAASVEETAAALEQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVD 552
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   553 AMTGIEQSSQSISNIIGVIDDIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSATAAKEIKALIT------- 625
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKeiqeetn 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   626 -------SSGDQVKRGVDLVGQTGKALQAIVAEVQQINSNVQAVVQAAREQSTGLLEINTAVNQMDQSTQKNAAMVEESN 698
Cdd:smart00283 162 eavaameESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|
gi 116251086   699 AASHTLVTEVSALSERLAQF 718
Cdd:smart00283 242 AAAEELSGLAEELDELVERF 261
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
499-698 1.91e-60

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 203.62  E-value: 1.91e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 499 EQQAASVEETAAALEQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVDAMTGIEQSSQSISNIIGVIDDIAFQT 578
Cdd:cd11386    1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 579 NLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSATAAKEIKALITSSGDQVKRGVDLVGQTGKALQAIVAEVQQINSN 658
Cdd:cd11386   81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 116251086 659 VQAVVQAAREQSTGLLEINTAVNQMDQSTQKNAAMVEESN 698
Cdd:cd11386  161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Cache_1 pfam02743
Cache domain;
172-252 4.81e-12

Cache domain;


Pssm-ID: 251508  Cd Length: 80  Bit Score: 63.05  E-value: 4.81e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  172 VIEPYVYAVDGKdvLMTSVAKPIMVDGKALGVAGMDISLDDANKAISAVHPMETGYLSLVTGAGSIISHPSAELAGKNIK 251
Cdd:pfam02743   1 VTEPYVDAATGD--LVITIAQPVYDNGDLLGVIGLDVPLEDLLKITKSIKLGKTGYAFIIDNNGKVLAHPNHEPVTKLLG 78

                  .
gi 116251086  252 D 252
Cdd:pfam02743  79 D 79
HAMP pfam00672
HAMP domain;
319-388 2.00e-07

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 49.15  E-value: 2.00e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  319 VAITAIAALLLGLSGWLIARKFIRRIEGVIAETDRIAHGQLDVQLSDKnAKDEIGDLSRSLAILLESNRQ 388
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVS-GPDEIGELARAFNQMADRLRE 70
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
473-718 1.57e-78

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 255.67  E-value: 1.57e-78
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   473 FSENAAVIQAGSEEIRSGADDLARRTEQQAASVEETAAALEQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVD 552
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   553 AMTGIEQSSQSISNIIGVIDDIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSATAAKEIKALIT------- 625
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKeiqeetn 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   626 -------SSGDQVKRGVDLVGQTGKALQAIVAEVQQINSNVQAVVQAAREQSTGLLEINTAVNQMDQSTQKNAAMVEESN 698
Cdd:smart00283 162 eavaameESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|
gi 116251086   699 AASHTLVTEVSALSERLAQF 718
Cdd:smart00283 242 AAAEELSGLAEELDELVERF 261
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
366-720 1.08e-74

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 250.29  E-value: 1.08e-74
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 366 KNAKDEIGDLSRSLAILLESNRQKIKLEADAETSRAREEVERQERSVHHAARE--DSIKFAVSELGNGLASLSNGDMTIR 443
Cdd:COG0840   27 KKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILllRAILEPISDLLEVVERIAAGDLTKR 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 444 LEKPFADSLDEIRVDFNASVEKLQAALISFSENAAVIQAGSEEIRSGADDLARRTEQQAASVEETAAALEQITTSIKDST 523
Cdd:COG0840  107 IDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVA 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 524 LRAEEAGALVSRTKDGAEKSGEVVRNAVDAMTGIE-----------QSSQSISNIIGVIDDIAFQTNLLALNAGVEAARA 592
Cdd:COG0840  187 FNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAeelaevvkklsESSQEIEEITSVINSIAEQTNLLALNAAIEAARA 266
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 593 GEAGKGFAVVAQEVRELAQRSATAAKEIKALITS--------------SGDQVKRGVDLVGQTGKALQAIVAEVQQINSN 658
Cdd:COG0840  267 GEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEiqneaadavehmeeSASEVSEGVKLVEETGSSLGEIAAAIEEVSQL 346
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 116251086 659 VQAVVQAAREQSTGLLEINTAVNQMDQSTQKNAAMVEESNAASHTLVTEVSALSERLAQFNL 720
Cdd:COG0840  347 ISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
435-758 8.83e-67

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 232.54  E-value: 8.83e-67
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 435 LSNGDMTIRLEKPFADSLDEIRvdfnASVEKLQAALIS----FSENAAVIQAGSEEIRSGADDLARRTEQQAASVEETAA 510
Cdd:PRK15041 232 IAGGDLVKPIEVDGSNEMGQLA----ESLRHMQGELMRtvgdVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAA 307
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 511 ALEQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVDAMTGIEQSSQSISNIIGVIDDIAFQTNLLALNAGVEAA 590
Cdd:PRK15041 308 SMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAA 387
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 591 RAGEAGKGFAVVAQEVRELAQRSATAAKEIKALITSSGDQVKRGVDLVGQTGKALQAIVAEVQQINSNVQAVVQAAREQS 670
Cdd:PRK15041 388 RAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQS 467
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 671 TGLLEINTAVNQMDQSTQKNAAMVEESNAASHTLVTEVSALSERLAQFNLGQtanAAPAARTTAKplARPVAATLAARRP 750
Cdd:PRK15041 468 RGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQQ---QQQQQRETSA--VVKTVTPATPRKM 542

                 ....*...
gi 116251086 751 VPASATDH 758
Cdd:PRK15041 543 AVADSGEN 550
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
538-721 2.23e-52

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 181.49  E-value: 2.23e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  538 DGAEKSGEVVRNAVDAMTGIEQSSQSISNIIGVIDDIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSATAA 617
Cdd:pfam00015  16 DEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAA 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  618 KEIKALI--------------TSSGDQVKRGVDLVGQTGKALQAIVAEVQQINSNVQAVVQAAREQSTGLLEINTAVNQM 683
Cdd:pfam00015  96 KEIEALIeeivkqtndstasiQQTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSAGIDQVNQAVARI 175
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 116251086  684 DQSTQKNAAMVEESNAASHTLVTEVSALSERLAQFNLG 721
Cdd:pfam00015 176 DQVTQQNAALVEESAAAAETLEEQAEELTASVAQFRIK 213
marine_sort_HK TIGR03785
proteobacterial dedicated sortase system histidine kinase; This histidine kinase protein is ...
221-383 5.02e-05

proteobacterial dedicated sortase system histidine kinase; This histidine kinase protein is paired with an adjacent response regulator (TIGR03787) gene. It co-occurs with a variant sortase enzyme (TIGR03784), usually in the same gene neighborhood, in proteobacterial species most of which are marine, and with an LPXTG motif-containing sortase target conserved protein (TIGR03788). Sortases and LPXTG proteins are far more common in Gram-positive bacteria, where sortase systems mediate attachment to the cell wall or cross-linking of pilin structures. We give this predicted sensor histidine kinase the gene symbol psdS, for Proteobacterial Dedicated Sortase system Sensor histidine kinase.


Pssm-ID: 163497 [Multi-domain]  Cd Length: 703  Bit Score: 45.50  E-value: 5.02e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  221 HPMetGYLSLVTGAGSIIS--HPSAELAGKNIKDGgdltagwdqLIAKPGVAREIAARDGKTYFSVAYPVKLTTDLnwYA 298
Cdd:TIGR03785 320 HPL--YYKILTKPPADFIDqlQDSQALEGSHIIKA---------LQGQPASTWRLSPDSKAVILSAAYPIWIDTEV--LG 386
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  299 VVSVPKST-VFAQLDNMAWSA-----VAITAIAAL-LLGLSGWLIARkfIRR----IEGVIAETDRIAHgqlDVQLSdkN 367
Cdd:TIGR03785 387 AVIAEQTTnGIRTLRNSALEKlfnviLAIMSIGTLaLFGFASWISWR--IRRlsddAEAAIDSQGRISG---AIPAS--R 459
                         170
                  ....*....|....*.
gi 116251086  368 AKDEIGDLSRSLAILL 383
Cdd:TIGR03785 460 SRDEIGDLSRSFAQMV 475
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
374-668 5.25e-05

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 45.43  E-value: 5.25e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   374 DLSRSLAILLESNRQKIKLEADAETSRAREEVERQERSVHHAAREDSIKFAVSELGNGLASL--SNGDM----------- 440
Cdd:TIGR02168  187 NLDRLEDILNELERQLKSLERQAEKAERYKELKAELRELELALLVLRLEELREELEELQEELkeAEEELeeltaelqele 266
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   441 ----TIRLEKPFADS-LDEIRVDFNAS---VEKLQAALISFSENAAVIQAGSEEIRSGADDLARRTEQQAASVEETAAAL 512
Cdd:TIGR02168  267 ekleELRLEVSELEEeIEELQKELYALaneISRLEQQKQILRERLANLERQLEELEAQLEELESKLDELAEELAELEEKL 346
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   513 EQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVDAMTGIEQSSQSISNIIGVID----DIA-----FQTNLLAL 583
Cdd:TIGR02168  347 EELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEarleRLEdrrerLQQEIEEL 426
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   584 NAGVEAARAGEAGKGFAVVAQEVRELAQRSATA------AKEIKALITSSGDQVKRGVDLVGQTGKALQAIVAEVQQINS 657
Cdd:TIGR02168  427 LKKLEEAELKELQAELEELEEELEELQEELERLeealeeLREELEEAEQALDAAERELAQLQARLDSLERLQENLEGFSE 506
                          330
                   ....*....|.
gi 116251086   658 NVQAVVQAARE 668
Cdd:TIGR02168  507 GVKALLKNQSG 517
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
714-784 1.02e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 41.01  E-value: 1.02e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 116251086 714 RLAQFNLGQTANAAPAARTTAKPLARPVAATLAARRPVPASATDHARPAPSPARALGGKLAAAFGTSAAPA 784
Cdd:PRK12323 359 RMLAFRPGQSGGGAGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPA 429
NtrY COG5000
Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation ...
321-402 1.60e-03

Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms]


Pssm-ID: 227333 [Multi-domain]  Cd Length: 712  Bit Score: 40.52  E-value: 1.60e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 321 ITAIAALLLGLsgwLIARKFIRRIEGVIAETDRIAHGQLDVQLSDKNAKDEIGDLSRSLAIL---LESNRQKIKLEADAE 397
Cdd:COG5000  289 LVLLAAIWTAI---AFARRIVRPIRKLIEAADEVADGDLDVQVPVRRVDEDVGRLSKAFNKMteqLSSQQEALERAKDAL 365

                 ....*
gi 116251086 398 TSRAR 402
Cdd:COG5000  366 EQRRR 370
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
499-698 1.91e-60

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 203.62  E-value: 1.91e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 499 EQQAASVEETAAALEQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVDAMTGIEQSSQSISNIIGVIDDIAFQT 578
Cdd:cd11386    1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 579 NLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSATAAKEIKALITSSGDQVKRGVDLVGQTGKALQAIVAEVQQINSN 658
Cdd:cd11386   81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 116251086 659 VQAVVQAAREQSTGLLEINTAVNQMDQSTQKNAAMVEESN 698
Cdd:cd11386  161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Cache_1 pfam02743
Cache domain;
172-252 4.81e-12

Cache domain;


Pssm-ID: 251508  Cd Length: 80  Bit Score: 63.05  E-value: 4.81e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  172 VIEPYVYAVDGKdvLMTSVAKPIMVDGKALGVAGMDISLDDANKAISAVHPMETGYLSLVTGAGSIISHPSAELAGKNIK 251
Cdd:pfam02743   1 VTEPYVDAATGD--LVITIAQPVYDNGDLLGVIGLDVPLEDLLKITKSIKLGKTGYAFIIDNNGKVLAHPNHEPVTKLLG 78

                  .
gi 116251086  252 D 252
Cdd:pfam02743  79 D 79
HAMP pfam00672
HAMP domain;
319-388 2.00e-07

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 49.15  E-value: 2.00e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  319 VAITAIAALLLGLSGWLIARKFIRRIEGVIAETDRIAHGQLDVQLSDKnAKDEIGDLSRSLAILLESNRQ 388
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVS-GPDEIGELARAFNQMADRLRE 70
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
473-718 1.57e-78

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 255.67  E-value: 1.57e-78
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   473 FSENAAVIQAGSEEIRSGADDLARRTEQQAASVEETAAALEQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVD 552
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   553 AMTGIEQSSQSISNIIGVIDDIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSATAAKEIKALIT------- 625
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKeiqeetn 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   626 -------SSGDQVKRGVDLVGQTGKALQAIVAEVQQINSNVQAVVQAAREQSTGLLEINTAVNQMDQSTQKNAAMVEESN 698
Cdd:smart00283 162 eavaameESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|
gi 116251086   699 AASHTLVTEVSALSERLAQF 718
Cdd:smart00283 242 AAAEELSGLAEELDELVERF 261
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
366-720 1.08e-74

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 250.29  E-value: 1.08e-74
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 366 KNAKDEIGDLSRSLAILLESNRQKIKLEADAETSRAREEVERQERSVHHAARE--DSIKFAVSELGNGLASLSNGDMTIR 443
Cdd:COG0840   27 KKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILllRAILEPISDLLEVVERIAAGDLTKR 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 444 LEKPFADSLDEIRVDFNASVEKLQAALISFSENAAVIQAGSEEIRSGADDLARRTEQQAASVEETAAALEQITTSIKDST 523
Cdd:COG0840  107 IDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVA 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 524 LRAEEAGALVSRTKDGAEKSGEVVRNAVDAMTGIE-----------QSSQSISNIIGVIDDIAFQTNLLALNAGVEAARA 592
Cdd:COG0840  187 FNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAeelaevvkklsESSQEIEEITSVINSIAEQTNLLALNAAIEAARA 266
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 593 GEAGKGFAVVAQEVRELAQRSATAAKEIKALITS--------------SGDQVKRGVDLVGQTGKALQAIVAEVQQINSN 658
Cdd:COG0840  267 GEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEiqneaadavehmeeSASEVSEGVKLVEETGSSLGEIAAAIEEVSQL 346
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 116251086 659 VQAVVQAAREQSTGLLEINTAVNQMDQSTQKNAAMVEESNAASHTLVTEVSALSERLAQFNL 720
Cdd:COG0840  347 ISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
435-758 8.83e-67

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 232.54  E-value: 8.83e-67
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 435 LSNGDMTIRLEKPFADSLDEIRvdfnASVEKLQAALIS----FSENAAVIQAGSEEIRSGADDLARRTEQQAASVEETAA 510
Cdd:PRK15041 232 IAGGDLVKPIEVDGSNEMGQLA----ESLRHMQGELMRtvgdVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAA 307
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 511 ALEQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVDAMTGIEQSSQSISNIIGVIDDIAFQTNLLALNAGVEAA 590
Cdd:PRK15041 308 SMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAA 387
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 591 RAGEAGKGFAVVAQEVRELAQRSATAAKEIKALITSSGDQVKRGVDLVGQTGKALQAIVAEVQQINSNVQAVVQAAREQS 670
Cdd:PRK15041 388 RAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQS 467
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 671 TGLLEINTAVNQMDQSTQKNAAMVEESNAASHTLVTEVSALSERLAQFNLGQtanAAPAARTTAKplARPVAATLAARRP 750
Cdd:PRK15041 468 RGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQQ---QQQQQRETSA--VVKTVTPATPRKM 542

                 ....*...
gi 116251086 751 VPASATDH 758
Cdd:PRK15041 543 AVADSGEN 550
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
458-759 6.90e-65

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 227.20  E-value: 6.90e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 458 DFNASVEKLQAALIS----FSENAAVIQAGSEEIRSGADDLARRTEQQAASVEETAAALEQITTSIKDSTLRAEEAGALV 533
Cdd:PRK15048 249 DLAQSVSHMQRSLTDtvthVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADNARQASQLA 328
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 534 SRTKDGAEKSGEVVRNAVDAMTGIEQSSQSISNIIGVIDDIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRS 613
Cdd:PRK15048 329 QSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRS 408
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 614 ATAAKEIKALITSSGDQVKRGVDLVGQTGKALQAIVAEVQQINSNVQAVVQAAREQSTGLLEINTAVNQMDQSTQKNAAM 693
Cdd:PRK15048 409 AQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASL 488
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 116251086 694 VEESNAASHTLVTEVSALSERLAQFNLgqtanaAPAARTTAKPLARPVAATLAARRPVPASATDHA 759
Cdd:PRK15048 489 VQESAAAAAALEEQASRLTQAVSAFRL------AASPLTNKPQTPSRPASEQPPAQPRLRIAEQDP 548
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
453-737 3.29e-62

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 219.17  E-value: 3.29e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 453 DEIRVDFnASVEKLQAAL----ISFSENAAVIQAGSEEIRSGADDLARRTEQQAASVEETAAALEQITTSIKDSTLRAEE 528
Cdd:PRK09793 243 NEITAIF-ASLKTMQQALrgtvSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVGQNADNARQ 321
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 529 AGALVSRTKDGAEKSGEVVRNAVDAMTGIEQSSQSISNIIGVIDDIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRE 608
Cdd:PRK09793 322 ASELAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRN 401
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 609 LAQRSATAAKEIKALITSSGDQVKRGVDLVGQTGKALQAIVAEVQQINSNVQAVVQAAREQSTGLLEINTAVNQMDQSTQ 688
Cdd:PRK09793 402 LASRSAQAAKEIKGLIEESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQVTQ 481
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 116251086 689 KNAAMVEESNAASHTLVTEVSALSERLAQFNLG-QTANAAPAARTTAKPL 737
Cdd:PRK09793 482 QNASLVEEAAVATEQLANQADHLSSRVAVFTLEeHEVARHESAQLQIAPV 531
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
538-721 2.23e-52

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 181.49  E-value: 2.23e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  538 DGAEKSGEVVRNAVDAMTGIEQSSQSISNIIGVIDDIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSATAA 617
Cdd:pfam00015  16 DEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAA 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  618 KEIKALI--------------TSSGDQVKRGVDLVGQTGKALQAIVAEVQQINSNVQAVVQAAREQSTGLLEINTAVNQM 683
Cdd:pfam00015  96 KEIEALIeeivkqtndstasiQQTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSAGIDQVNQAVARI 175
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 116251086  684 DQSTQKNAAMVEESNAASHTLVTEVSALSERLAQFNLG 721
Cdd:pfam00015 176 DQVTQQNAALVEESAAAAETLEEQAEELTASVAQFRIK 213
PRK02224 PRK02224
chromosome segregation protein; Provisional
391-727 1.97e-05

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 46.96  E-value: 1.97e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 391 KLEAD-AETSRAREEVERQERSVHHAA--REDSIKFAVSELGNGLAS----------LSNGDMTIRlekpfaDSLDEIRV 457
Cdd:PRK02224 262 DLRETiAETEREREELAEEVRDLRERLeeLEEERDDLLAEAGLDDADaeavearreeLEDRDEELR------DRLEECRV 335
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 458 DFNASVEKLQAALisfsENAAVIQAGSEEIRSGADDLARRTEQQAASVEETAAALEQITTSIKDstLRAEEAGALVSRtk 537
Cdd:PRK02224 336 AAQAHNEEAESLR----EDADDLEERAEELREEAAELESELEEAREAVEDRREEIEELEEEIEE--LRERFGDAPVDL-- 407
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 538 DGAEKSGEVVRNAVDAMTGIEQS-SQSISNIIGVIDdiafqtnllalnagvEAARAGEAGK-----------GFAVVAQE 605
Cdd:PRK02224 408 GNAEDFLEELREERDELREREAElEATLRTARERVE---------------EAEALLEAGKcpecgqpvegsPHVETIEE 472
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 606 VRELAQRSATAAKEIKALITSSGDQVKRGVDLVgqtgkalqAIVAEVQQINSNVQAVVQAAREQSTGLLEINTAVNQMDQ 685
Cdd:PRK02224 473 DRERVEELEAELEDLEEEVEEVEERLERAEDLV--------EAEDRIERLEERREDLEELIAERRETIEEKRERAEELRE 544
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|..
gi 116251086 686 STQKNAAMVEESNAASHTLVTEVSALSERLAQFNLGQTANAA 727
Cdd:PRK02224 545 RAAELEAEAEEKREAAAEAEEEAEEAREEVAELNSKLAELKE 586
marine_sort_HK TIGR03785
proteobacterial dedicated sortase system histidine kinase; This histidine kinase protein is ...
221-383 5.02e-05

proteobacterial dedicated sortase system histidine kinase; This histidine kinase protein is paired with an adjacent response regulator (TIGR03787) gene. It co-occurs with a variant sortase enzyme (TIGR03784), usually in the same gene neighborhood, in proteobacterial species most of which are marine, and with an LPXTG motif-containing sortase target conserved protein (TIGR03788). Sortases and LPXTG proteins are far more common in Gram-positive bacteria, where sortase systems mediate attachment to the cell wall or cross-linking of pilin structures. We give this predicted sensor histidine kinase the gene symbol psdS, for Proteobacterial Dedicated Sortase system Sensor histidine kinase.


Pssm-ID: 163497 [Multi-domain]  Cd Length: 703  Bit Score: 45.50  E-value: 5.02e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  221 HPMetGYLSLVTGAGSIIS--HPSAELAGKNIKDGgdltagwdqLIAKPGVAREIAARDGKTYFSVAYPVKLTTDLnwYA 298
Cdd:TIGR03785 320 HPL--YYKILTKPPADFIDqlQDSQALEGSHIIKA---------LQGQPASTWRLSPDSKAVILSAAYPIWIDTEV--LG 386
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  299 VVSVPKST-VFAQLDNMAWSA-----VAITAIAAL-LLGLSGWLIARkfIRR----IEGVIAETDRIAHgqlDVQLSdkN 367
Cdd:TIGR03785 387 AVIAEQTTnGIRTLRNSALEKlfnviLAIMSIGTLaLFGFASWISWR--IRRlsddAEAAIDSQGRISG---AIPAS--R 459
                         170
                  ....*....|....*.
gi 116251086  368 AKDEIGDLSRSLAILL 383
Cdd:TIGR03785 460 SRDEIGDLSRSFAQMV 475
PRK14965 PRK14965
DNA polymerase III subunits gamma and tau; Provisional
493-793 5.08e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237871 [Multi-domain]  Cd Length: 576  Bit Score: 45.12  E-value: 5.08e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 493 DLARRTEQQAASVEETAAALEQIttSIKDSTLraeeagALVSRTKDGAEKSGEVVRNAVDAMTGIEQSSQSISNIIGVID 572
Cdd:PRK14965 174 DFRRIPLQKIVDRLRYIADQEGI--SISDAAL------ALVARKGDGSMRDSLSTLDQVLAFCGDAVGDDDVAELLGVVD 245
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 573 DiafqtnlLALNAGVEAARAGEAGKGFAVVAQ------EVRELAQ------RSATAAKeikalitssgdqvkrgvdLVGQ 640
Cdd:PRK14965 246 R-------RLLLDISAAVFGRDTRALLEIVERvdefgyNMRQFCQelidhlRNLVVLR------------------AVGE 300
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 641 TGKALQAIVAEVQQINSNVQAVVQAAREQSTGLLEinTAVNQMDQSTQK----NAAMVEESNAAShtlVTEVSALSERLA 716
Cdd:PRK14965 301 PGDLLDLSEAELAELRAQAAAADAADLQRHLTLLL--RAEGEMAHASFPrlvlEMALLKMATLAP---GAPVSELLDRLE 375
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 116251086 717 QFNLGQTANAAPAARTTAKPLARPVAATLAARRPVPASATDHA-RPAPSPARALGGKLAAAFGTSAAPASTEGNWEEF 793
Cdd:PRK14965 376 ALERGAPAPPSAAWGAPTPAAPAAPPPAAAPPVPPAAPARPAAaRPAPAPAPPAAAAPPARSADPAAAASAGDRWRAF 453
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
374-668 5.25e-05

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 45.43  E-value: 5.25e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   374 DLSRSLAILLESNRQKIKLEADAETSRAREEVERQERSVHHAAREDSIKFAVSELGNGLASL--SNGDM----------- 440
Cdd:TIGR02168  187 NLDRLEDILNELERQLKSLERQAEKAERYKELKAELRELELALLVLRLEELREELEELQEELkeAEEELeeltaelqele 266
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   441 ----TIRLEKPFADS-LDEIRVDFNAS---VEKLQAALISFSENAAVIQAGSEEIRSGADDLARRTEQQAASVEETAAAL 512
Cdd:TIGR02168  267 ekleELRLEVSELEEeIEELQKELYALaneISRLEQQKQILRERLANLERQLEELEAQLEELESKLDELAEELAELEEKL 346
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   513 EQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVDAMTGIEQSSQSISNIIGVID----DIA-----FQTNLLAL 583
Cdd:TIGR02168  347 EELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEarleRLEdrrerLQQEIEEL 426
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   584 NAGVEAARAGEAGKGFAVVAQEVRELAQRSATA------AKEIKALITSSGDQVKRGVDLVGQTGKALQAIVAEVQQINS 657
Cdd:TIGR02168  427 LKKLEEAELKELQAELEELEEELEELQEELERLeealeeLREELEEAEQALDAAERELAQLQARLDSLERLQENLEGFSE 506
                          330
                   ....*....|.
gi 116251086   658 NVQAVVQAARE 668
Cdd:TIGR02168  507 GVKALLKNQSG 517
COG1511 COG1511
Predicted membrane protein [Function unknown]
513-740 5.91e-04

Predicted membrane protein [Function unknown]


Pssm-ID: 224428 [Multi-domain]  Cd Length: 780  Bit Score: 42.11  E-value: 5.91e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 513 EQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVDAMTGIEQSSQSISNIIGviddiAFQTNLLALNAGVEAARA 592
Cdd:COG1511  167 VVAFPTIYDLGGGVKGAADGAEKLKDGTDEASNGNKKLSDLLNTLNNSSATFSDGLN-----ALTSGLTTLTDGLNQLDS 241
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 593 GeaGKGFAVVAQEVRELAQRSATAAKEIKALITSSGDQVKRGVDLVGQTGKALQAIVAEVQQINSNVQAVvqaaREQSTG 672
Cdd:COG1511  242 G--LGTLAAGIGELKQGAEQLNEGIGEFSSGLSELNSGVQDLAAGVPQLNQGISALAAGLSLPDSLGDQF----SSLQEA 315
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 116251086 673 LLEINTAVNQMDQSTQKnAAMVEESNAASHTLVTEVSALSERLAQFNLGQTANAAPAARTTAKPLARP 740
Cdd:COG1511  316 LTQIAQGLKQKTSSSLE-AAQGSLSSLQSMLALSKSLDLTAEGATVDALGAPDGVQWLDESQKTLATL 382
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
331-672 6.93e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 41.98  E-value: 6.93e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   331 LSGWLIARKFIRRIEGVIAETDR-IAhgQLDVQLSDKNAKDEigdlsrSLAILLESNRQKIKLEADAETSRAREEVERQE 409
Cdd:TIGR02169  229 LKEKEALERQKEAIERQLASLEEeLE--KLTEEISELEKRLE------EIEQLLEELNKKIKDLGEEEQLRVKEKIGELE 300
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   410 RSVHHAarEDSIKFAVSELGNGLASLSNGDMTIRLEKPFADSLDEIRVDFNASVEKLQAALISfsenaaviqagSEEIRs 489
Cdd:TIGR02169  301 AEIASL--ERSIAEKERELEDAEERLAKLEAEIDKLLAEIEELEREIEEERKRRDKLTEEYAE-----------LKEEL- 366
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   490 gaDDLARRTEQQAASVEETAAALEQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVDAMTGIEQS-SQSISNII 568
Cdd:TIGR02169  367 --EDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELKRELDRLQEELQRLSEELADLNAAIAGIEAKiNELEEEKE 444
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086   569 GVIDDIAFQT-NLLALNAGVEAARAgeagKGFAvVAQEVRELAQRSATAAKEIKALITS---SGDQVKRGVDLVGQTGKA 644
Cdd:TIGR02169  445 DKALEIKKQEwKLEQLAADLSKYEQ----ELYD-LKEEYDRVEKELSKLQRELAEAEAQaraSEERVRGGRAVEEVLKAS 519
                          330       340
                   ....*....|....*....|....*...
gi 116251086   645 LQAIVAEVQQINSnVQAVVQAAREQSTG 672
Cdd:TIGR02169  520 IQGVHGTVAQLGS-VGERYATAIEVAAG 546
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
343-676 6.96e-04

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 42.01  E-value: 6.96e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  343 RIEGVIAETDRIAHGQLDVQLSDKNAKDEIGDLSRSLAILLES-NRQKIKLEAdAETSRAREEVERQERSVHHAAREDSI 421
Cdd:COG1196   647 EPSGSITGGSRNKRSSLAQKRELKELEEELAELEAQLEKLEEElKSLKNELRS-LEDLLEELRRQLEELERQLEELKREL 725
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  422 KFAVSELGNGLASLSngdmtirlekpfadSLDEIRVDFNASVEKLQAALisfsENAaviqagSEEIRSGADDLARRTEQQ 501
Cdd:COG1196   726 AALEEELEQLQSRLE--------------ELEEELEELEEELEELQERL----EEL------EEELESLEEALAKLKEEI 781
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  502 aasvEETAAALEQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVDAmtgIEQSSQSISNIIGVIDDIA-----F 576
Cdd:COG1196   782 ----EELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQE---IEELEEEIEELEEKLDELEeeleeL 854
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  577 QTNLLALNAGVEAARA--GEAGKGFAVVAQEVRELAQRSATAAKEIKALITSSGDQVKRGVDLVGQTGKALQAIVAEVQQ 654
Cdd:COG1196   855 EKELEELKEELEELEAekEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEE 934
                         330       340
                  ....*....|....*....|..
gi 116251086  655 INSNVQAVVQAAREQSTGLLEI 676
Cdd:COG1196   935 LEEEYEDTLETELEREIERLEE 956
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
714-784 1.02e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 41.01  E-value: 1.02e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 116251086 714 RLAQFNLGQTANAAPAARTTAKPLARPVAATLAARRPVPASATDHARPAPSPARALGGKLAAAFGTSAAPA 784
Cdd:PRK12323 359 RMLAFRPGQSGGGAGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPA 429
PRK02224 PRK02224
chromosome segregation protein; Provisional
349-613 1.12e-03

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 41.18  E-value: 1.12e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 349 AETDRIAHGQLDVQLsdKNAKDEIGDLSRSLAIL---LESNRQKIkleADAETSRAREEVERQE-RSVHHAAREDsikfa 424
Cdd:PRK02224 358 AEELREEAAELESEL--EEAREAVEDRREEIEELeeeIEELRERF---GDAPVDLGNAEDFLEElREERDELRER----- 427
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 425 VSELGnglASLSNGDMTIR------------------LEKPFADSLDEIRVdfnaSVEKLQAAL-------------ISF 473
Cdd:PRK02224 428 EAELE---ATLRTARERVEeaealleagkcpecgqpvEGSPHVETIEEDRE----RVEELEAELedleeeveeveerLER 500
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 474 SENAAVIQAGSEEIRSGADDLARRTEQQAASVEETAAALEQITTSIKDSTLRAEEAGALVSRTKDGAEKSGEVVRNAVDA 553
Cdd:PRK02224 501 AEDLVEAEDRIERLEERREDLEELIAERRETIEEKRERAEELRERAAELEAEAEEKREAAAEAEEEAEEAREEVAELNSK 580
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 116251086 554 MTGIEQSSQSISNIIGVIDDIAfqtnllalNAGVEAARAGEAGKGFAVVAQEVRE-LAQRS 613
Cdd:PRK02224 581 LAELKERIESLERIRTLLAAIA--------DAEDEIERLREKREALAELNDERRErLAEKR 633
NtrY COG5000
Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation ...
321-402 1.60e-03

Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms]


Pssm-ID: 227333 [Multi-domain]  Cd Length: 712  Bit Score: 40.52  E-value: 1.60e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 321 ITAIAALLLGLsgwLIARKFIRRIEGVIAETDRIAHGQLDVQLSDKNAKDEIGDLSRSLAIL---LESNRQKIKLEADAE 397
Cdd:COG5000  289 LVLLAAIWTAI---AFARRIVRPIRKLIEAADEVADGDLDVQVPVRRVDEDVGRLSKAFNKMteqLSSQQEALERAKDAL 365

                 ....*
gi 116251086 398 TSRAR 402
Cdd:COG5000  366 EQRRR 370
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
449-541 3.69e-03

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 38.19  E-value: 3.69e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086  449 ADSLDEIRVDFNASVEKLQAALISFSENAAVIQAGSEEIRSGA-----------------DDLARRTEQQAASVEETAAA 511
Cdd:pfam00015  92 AQAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGealkeivdavaeiadivQEIAAASDEQSAGIDQVNQA 171
                          90       100       110
                  ....*....|....*....|....*....|
gi 116251086  512 LEQITTSIKDSTLRAEEAGALVSRTKDGAE 541
Cdd:pfam00015 172 VARIDQVTQQNAALVEESAAAAETLEEQAE 201
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
707-789 4.73e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 38.93  E-value: 4.73e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116251086 707 EVSALSE---RLAQFNLGQTANAAPAARttAKPLARPVAATLAA-RRPVPASATDHARPAPSPARALGGKLAAAFGTSAA 782
Cdd:PRK14951 350 EYAALTMvllRLLAFKPAAAAEAAAPAE--KKTPARPEAAAPAAaPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVA 427

                 ....*..
gi 116251086 783 PASTEGN 789
Cdd:PRK14951 428 APAAAAP 434
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH