NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|116250530|ref|YP_766368|]
View 

methyl-accepting chemotaxis protein [Rhizobium leguminosarum bv. viciae 3841]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
379-578 1.36e-53

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


:

Pssm-ID: 206779  Cd Length: 200  Bit Score: 182.82  E-value: 1.36e-53
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 379 EAQAANLEETAAAVEEITVTVRSSAERAREANNVVAATKKTADNSGAVVGDAVAAMDRIEQASQRIEQIIEVIDDIAFQT 458
Cdd:cd11386    1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 459 NLLALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIETSSREVTAGSELVQKTGSVLASISQEIIAISGH 538
Cdd:cd11386   81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 116250530 539 VETIATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAETT 578
Cdd:cd11386  161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
199-268 8.39e-06

HAMP domain;


:

Pssm-ID: 250044  Cd Length: 70  Bit Score: 44.14  E-value: 8.39e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  199 LGVGAIVMLIVGVLAFYAIRLSVKPLQALTTSVHSISAGDLEGAIPcVEKRNEFGDIGRALALFRDSARA 268
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVP-VSGPDEIGELARAFNQMADRLRE 70
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
353-599 2.66e-71

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


:

Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 232.56  E-value: 2.66e-71
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   353 IRDSAATIQRNSGAVSASAGELSKRTEAQAANLEETAAAVEEITVTVRSSAERAREANNVVAATKKTADNSGAVVGDAVA 432
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   433 AMDRIEQASQRIEQIIEVIDDIAFQTNLLALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIET------ 506
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEiqeetn 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   507 --------SSREVTAGSELVQKTGSVLASISQEIIAISGHVETIATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAETT 578
Cdd:smart00283 162 eavaameeSSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|.
gi 116250530   579 QASRLLAGEADTLMALIERFR 599
Cdd:smart00283 242 AAAEELSGLAEELDELVERFK 262
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
379-578 1.36e-53

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 182.82  E-value: 1.36e-53
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 379 EAQAANLEETAAAVEEITVTVRSSAERAREANNVVAATKKTADNSGAVVGDAVAAMDRIEQASQRIEQIIEVIDDIAFQT 458
Cdd:cd11386    1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 459 NLLALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIETSSREVTAGSELVQKTGSVLASISQEIIAISGH 538
Cdd:cd11386   81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 116250530 539 VETIATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAETT 578
Cdd:cd11386  161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
199-268 8.39e-06

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 44.14  E-value: 8.39e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  199 LGVGAIVMLIVGVLAFYAIRLSVKPLQALTTSVHSISAGDLEGAIPcVEKRNEFGDIGRALALFRDSARA 268
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVP-VSGPDEIGELARAFNQMADRLRE 70
ResE COG2770
FOG: HAMP domain [Signal transduction mechanisms]
202-272 2.39e-03

FOG: HAMP domain [Signal transduction mechanisms]


Pssm-ID: 225359  Cd Length: 83  Bit Score: 36.58  E-value: 2.39e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 116250530 202 GAIVMLIVGVLAFYAIRLSVKPLQALTTSVHSISAGDLEGAIPcVEKRNEFGDIGRALALFRDSARARRDL 272
Cdd:COG2770   12 VLALVLILAVLLLAAARRVTRPLRRLADLAQNLALGDLSAEIP-QPMLDEIGELAKAFNRMRDSLQRALSA 81
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
218-271 9.16e-03

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 34.53  E-value: 9.16e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 116250530   218 RLSVKPLQALTTSVHSISAGDLEGAIPcVEKRNEFGDIGRALALFRDSARARRD 271
Cdd:smart00304   1 RRLLRPLRRLAEAAQRIADGDLTVRLP-VDGRDEIGELARAFNEMADRLEETIA 53
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
353-599 2.66e-71

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 232.56  E-value: 2.66e-71
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   353 IRDSAATIQRNSGAVSASAGELSKRTEAQAANLEETAAAVEEITVTVRSSAERAREANNVVAATKKTADNSGAVVGDAVA 432
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   433 AMDRIEQASQRIEQIIEVIDDIAFQTNLLALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIET------ 506
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEiqeetn 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   507 --------SSREVTAGSELVQKTGSVLASISQEIIAISGHVETIATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAETT 578
Cdd:smart00283 162 eavaameeSSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|.
gi 116250530   579 QASRLLAGEADTLMALIERFR 599
Cdd:smart00283 242 AAAEELSGLAEELDELVERFK 262
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
247-600 1.75e-67

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 227.18  E-value: 1.75e-67
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 247 EKRNEFGDIGRALALFRDSARARRDLETQAAEQRELSDAERARNDA--DKRSLDGQIDFAVNQLAAGLGRLSQGDVSQTI 324
Cdd:COG0840   28 KLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVlvLAILLLRAILEPISDLLEVVERIAAGDLTKRI 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 325 GTPFVGRLEQLRVDFNASLLRLQDTLSGIRDSAATIQRNSGAVSASAGELSKRTEAQAANLEETAAAVEEITVTVRSSAE 404
Cdd:COG0840  108 DESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAF 187
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 405 RAREANNVVAATKKTADNSGAVVGDAVAAMDRIE-----------QASQRIEQIIEVIDDIAFQTNLLALNAGIEAARAG 473
Cdd:COG0840  188 NAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAeelaevvkklsESSQEIEEITSVINSIAEQTNLLALNAAIEAARAG 267
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 474 EAGKGFAVVAQEVRELAQRSADAAREIKSLIET--------------SSREVTAGSELVQKTGSVLASISQEIIAISGHV 539
Cdd:COG0840  268 EAGRGFAVVADEVRKLAERSADSAKEIGLLIEEiqneaadavehmeeSASEVSEGVKLVEETGSSLGEIAAAIEEVSQLI 347
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 116250530 540 ETIATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAETTQASRLLAGEADTLMALIERFRI 600
Cdd:COG0840  348 SEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
305-603 1.30e-63

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 220.60  E-value: 1.30e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 305 VNQLAAGLGRLSQGDVSQTI---GTPFVGRLEQLRVDFNASLLRlqdTLSGIRDSAATIQRNSGAVSASAGELSKRTEAQ 381
Cdd:PRK15041 222 MNRLIDSIRHIAGGDLVKPIevdGSNEMGQLAESLRHMQGELMR---TVGDVRNGANAIYSGASEIATGNNDLSSRTEQQ 298
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 382 AANLEETAAAVEEITVTVRSSAERAREANNVVAATKKTADNSGAVVGDAVAAMDRIEQASQRIEQIIEVIDDIAFQTNLL 461
Cdd:PRK15041 299 AASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNIL 378
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 462 ALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIETSSREVTAGSELVQKTGSVLASISQEIIAISGHVET 541
Cdd:PRK15041 379 ALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGE 458
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 116250530 542 IATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAETTQASRLLAGEADTLMALIERFRIVAE 603
Cdd:PRK15041 459 IASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQQQ 520
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
400-600 2.88e-49

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 171.47  E-value: 2.88e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  400 RSSAERAREANNvvaATKKTADNSGAVVGDAVAAMDRIEQASQRIEQIIEVIDDIAFQTNLLALNAGIEAARAGEAGKGF 479
Cdd:pfam00015   1 AQASDLAQLASE---EALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGF 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  480 AVVAQEVRELAQRSADAAREIKSLIETSSR--------------EVTAGSELVQKTGSVLASISQEIIAISGHVETIATA 545
Cdd:pfam00015  78 AVVADEVRKLAERSAQAAKEIEALIEEIVKqtndstasiqqtrtEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAA 157
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 116250530  546 SRDQSAALQEVNGSVNAMDQMTQKNAAMVAETTQASRLLAGEADTLMALIERFRI 600
Cdd:pfam00015 158 SDEQSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQFRI 212
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
365-603 2.52e-05

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 46.20  E-value: 2.52e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   365 GAVSASAGELSKRTEAQ--AANLEETAAAVEEITVTVRSSAERAREANNVVAATKKTADN----SGAVVGDAVAAMDRIE 438
Cdd:TIGR02168  664 GSAKTNSSILERRREIEelEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEElsrqISALRKDLARLEAEVE 743
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   439 QASQRIEQIIEVIDDIAFQTNLLALNAGIEAARAGEAgkgfAVVAQEVRELAQRSADAAREIKSLIETSSREVTAGSELV 518
Cdd:TIGR02168  744 QLEERIAQLSKELTELEAEIEELEERLEEAEEELAEA----EAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEA 819
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   519 QKTGSVLASISQEIIAISGHVETIATASRDQSAALQEVNGSvnaMDQMTQKNAAMVAETTQASRLLAGEADTLMALIERF 598
Cdd:TIGR02168  820 ANLRERLESLERRIAATERRLEDLEEQIEELSEDIESLAAE---IEELEELIEELESELEALLNERASLEEALALLRSEL 896

                   ....*
gi 116250530   599 RIVAE 603
Cdd:TIGR02168  897 EELSE 901
PRK10935 PRK10935
nitrate/nitrite sensor protein NarQ; Provisional
189-287 2.16e-04

nitrate/nitrite sensor protein NarQ; Provisional


Pssm-ID: 236800 [Multi-domain]  Cd Length: 565  Bit Score: 42.92  E-value: 2.16e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 189 QRMYELQM-LVLGVGAIVMLIVGVLAFYAIRLS----VKPLQALTTSVHSISAGDLEGAIPCVEKRNEFGDIGRAL-ALF 262
Cdd:PRK10935 140 QHFAERKLiLLAAISLLGLILILTLVFFTVRFTrrqvVAPLNQLVTASQQIEKGQFDHIPLDTTLPNELGLLAKAFnQMS 219
                         90       100
                 ....*....|....*....|....*.
gi 116250530 263 RDSARARRDLETQAAEQ-RELSDAER 287
Cdd:PRK10935 220 SELHKLYRSLEASVEEKtRKLTQANR 245
TIGR02680 TIGR02680
TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene ...
254-440 3.32e-04

TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length [Hypothetical proteins, Conserved].


Pssm-ID: 233973 [Multi-domain]  Cd Length: 1353  Bit Score: 42.49  E-value: 3.32e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   254 DIGRALALFRDSA-------RARRDLETQAAEQRElsDAERARNDADKRSldgqidfavNQLAAGLGRLSQGDVsqtigt 326
Cdd:TIGR02680  848 AVGLALKRFGDHLhtlevavRELRHAATRAAEQRA--RAARAESDAREAA---------EDAAEARAEAEEASL------ 910
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   327 pfvgRLEQLRVDFNASLLRLQDTLSGIRDSAATIQRNSGAvsasAGELSKRTEAQAANLEETAAAVEEITVTVRSSAERA 406
Cdd:TIGR02680  911 ----RLRTLEESVGAMVDEIRARLAETRAALASGGRELPR----LAEALATAEEARGRAEEKRAEADATLDERAEARDHA 982
                          170       180       190
                   ....*....|....*....|....*....|....
gi 116250530   407 REANNVVAATKKTADNSGAVVGDAVAAMDRIEQA 440
Cdd:TIGR02680  983 IGQLREFALTGLLEDALPDTEVPELDAKWTIEAA 1016
NarQ COG3850
Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms]
193-287 5.52e-04

Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms]


Pssm-ID: 226368 [Multi-domain]  Cd Length: 574  Bit Score: 41.56  E-value: 5.52e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 193 ELQMLVLGVGAIVMLIVGVLAFYAIRLSV-KPLQALTTSVHSISAGDLEgAIPCVEKRNEFGDIGRAL-ALFRDSARARR 270
Cdd:COG3850  147 ILLVLVQLAGMLLILLLVVFTIYWLRRRVvRPLNQLTSAAQRIGRRQFD-QRPTDTGRNELGLLGRAFnQMSGELKKLYA 225
                         90
                 ....*....|....*...
gi 116250530 271 DLETQAAEQ-RELSDAER 287
Cdd:COG3850  226 DLEQRVEEKtRDLEQKNQ 243
DUF390 pfam04094
Protein of unknown function (DUF390); This is a family of long proteins currently only found ...
272-409 1.28e-03

Protein of unknown function (DUF390); This is a family of long proteins currently only found in the rice genome. They have no known function. However they may be some kind of transposable element.


Pssm-ID: 112890 [Multi-domain]  Cd Length: 843  Bit Score: 40.57  E-value: 1.28e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  272 LETQAAEQRELsDAERARNDADKRSLDGQIDFA-------VNQLAAGLGRLSQ--GDVSQTIGTPFVGRL------EQLR 336
Cdd:pfam04094 406 MEALQAERAEL-DAAWARVEEGRRSVEAMVEAGrkahrrhTSELEARKKDLAEiaKEVEEEREAALIATTvlneaqDDLR 484
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  337 VDFN---ASLLRLQDTLSGIRDSAATIQRNSGAVSASAGELSKRTEAQAANLEETAAAVE------EITVTVRSSAERAR 407
Cdd:pfam04094 485 LQYGsraAELEKKLDAAQGVLDAAAAREQRAAENEAASRQREEALEARAMALEERACAKErdladrEAAVAIREATLAAH 564

                  ..
gi 116250530  408 EA 409
Cdd:pfam04094 565 EA 566
PHA03332 PHA03332
membrane glycoprotein; Provisional
455-605 2.61e-03

membrane glycoprotein; Provisional


Pssm-ID: 223047 [Multi-domain]  Cd Length: 1328  Bit Score: 39.57  E-value: 2.61e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  455 AFQTNLLALNAGIEAARageagkgfavVAQEVRELAQRSADAAREIKSLIETSSREVTAGSELVQKTGSVLASISqeiia 534
Cdd:PHA03332  861 AFTMASAALNAATQALA----------VATLYVNQLLQATAATAEMASKIGGLNARVDKTSDVITKLGDTIAKIS----- 925
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 116250530  535 isghvetiATASRDqsaaLQEVNGSVNAMDQmtQKNAAMVAETTQASRLLAGEADTLMALIERFRIVAESA 605
Cdd:PHA03332  926 --------ATLDNN----IRAVNGRVSDLED--QVNLRFLAVATNFNTLATQLKELGTTTNERIEEVMAAA 982
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
379-578 1.36e-53

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 182.82  E-value: 1.36e-53
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 379 EAQAANLEETAAAVEEITVTVRSSAERAREANNVVAATKKTADNSGAVVGDAVAAMDRIEQASQRIEQIIEVIDDIAFQT 458
Cdd:cd11386    1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 459 NLLALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIETSSREVTAGSELVQKTGSVLASISQEIIAISGH 538
Cdd:cd11386   81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 116250530 539 VETIATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAETT 578
Cdd:cd11386  161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
199-268 8.39e-06

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 44.14  E-value: 8.39e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  199 LGVGAIVMLIVGVLAFYAIRLSVKPLQALTTSVHSISAGDLEGAIPcVEKRNEFGDIGRALALFRDSARA 268
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVP-VSGPDEIGELARAFNQMADRLRE 70
ResE COG2770
FOG: HAMP domain [Signal transduction mechanisms]
202-272 2.39e-03

FOG: HAMP domain [Signal transduction mechanisms]


Pssm-ID: 225359  Cd Length: 83  Bit Score: 36.58  E-value: 2.39e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 116250530 202 GAIVMLIVGVLAFYAIRLSVKPLQALTTSVHSISAGDLEGAIPcVEKRNEFGDIGRALALFRDSARARRDL 272
Cdd:COG2770   12 VLALVLILAVLLLAAARRVTRPLRRLADLAQNLALGDLSAEIP-QPMLDEIGELAKAFNRMRDSLQRALSA 81
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
218-271 9.16e-03

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 34.53  E-value: 9.16e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 116250530   218 RLSVKPLQALTTSVHSISAGDLEGAIPcVEKRNEFGDIGRALALFRDSARARRD 271
Cdd:smart00304   1 RRLLRPLRRLAEAAQRIADGDLTVRLP-VDGRDEIGELARAFNEMADRLEETIA 53
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
353-599 2.66e-71

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 232.56  E-value: 2.66e-71
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   353 IRDSAATIQRNSGAVSASAGELSKRTEAQAANLEETAAAVEEITVTVRSSAERAREANNVVAATKKTADNSGAVVGDAVA 432
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   433 AMDRIEQASQRIEQIIEVIDDIAFQTNLLALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIET------ 506
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEiqeetn 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   507 --------SSREVTAGSELVQKTGSVLASISQEIIAISGHVETIATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAETT 578
Cdd:smart00283 162 eavaameeSSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|.
gi 116250530   579 QASRLLAGEADTLMALIERFR 599
Cdd:smart00283 242 AAAEELSGLAEELDELVERFK 262
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
247-600 1.75e-67

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 227.18  E-value: 1.75e-67
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 247 EKRNEFGDIGRALALFRDSARARRDLETQAAEQRELSDAERARNDA--DKRSLDGQIDFAVNQLAAGLGRLSQGDVSQTI 324
Cdd:COG0840   28 KLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVlvLAILLLRAILEPISDLLEVVERIAAGDLTKRI 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 325 GTPFVGRLEQLRVDFNASLLRLQDTLSGIRDSAATIQRNSGAVSASAGELSKRTEAQAANLEETAAAVEEITVTVRSSAE 404
Cdd:COG0840  108 DESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAF 187
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 405 RAREANNVVAATKKTADNSGAVVGDAVAAMDRIE-----------QASQRIEQIIEVIDDIAFQTNLLALNAGIEAARAG 473
Cdd:COG0840  188 NAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAeelaevvkklsESSQEIEEITSVINSIAEQTNLLALNAAIEAARAG 267
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 474 EAGKGFAVVAQEVRELAQRSADAAREIKSLIET--------------SSREVTAGSELVQKTGSVLASISQEIIAISGHV 539
Cdd:COG0840  268 EAGRGFAVVADEVRKLAERSADSAKEIGLLIEEiqneaadavehmeeSASEVSEGVKLVEETGSSLGEIAAAIEEVSQLI 347
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 116250530 540 ETIATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAETTQASRLLAGEADTLMALIERFRI 600
Cdd:COG0840  348 SEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
305-603 1.30e-63

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 220.60  E-value: 1.30e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 305 VNQLAAGLGRLSQGDVSQTI---GTPFVGRLEQLRVDFNASLLRlqdTLSGIRDSAATIQRNSGAVSASAGELSKRTEAQ 381
Cdd:PRK15041 222 MNRLIDSIRHIAGGDLVKPIevdGSNEMGQLAESLRHMQGELMR---TVGDVRNGANAIYSGASEIATGNNDLSSRTEQQ 298
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 382 AANLEETAAAVEEITVTVRSSAERAREANNVVAATKKTADNSGAVVGDAVAAMDRIEQASQRIEQIIEVIDDIAFQTNLL 461
Cdd:PRK15041 299 AASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNIL 378
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 462 ALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIETSSREVTAGSELVQKTGSVLASISQEIIAISGHVET 541
Cdd:PRK15041 379 ALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGE 458
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 116250530 542 IATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAETTQASRLLAGEADTLMALIERFRIVAE 603
Cdd:PRK15041 459 IASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQQQ 520
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
307-602 2.40e-58

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 206.01  E-value: 2.40e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 307 QLAAGLGRLSQGDVSQTIGTPFVGRLEQLRVDFNASLLRLQDTLSGIRDSAATIQRNSGAVSASAGELSKRTEAQAANLE 386
Cdd:PRK15048 222 KIIAHIREIAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALE 301
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 387 ETAAAVEEITVTVRSSAERAREANNVVAATKKTADNSGAVVGDAVAAMDRIEQASQRIEQIIEVIDDIAFQTNLLALNAG 466
Cdd:PRK15048 302 ETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAA 381
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 467 IEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIETSSREVTAGSELVQKTGSVLASISQEIIAISGHVETIATAS 546
Cdd:PRK15048 382 VEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASAS 461
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 116250530 547 RDQSAALQEVNGSVNAMDQMTQKNAAMVAETTQASRLLAGEADTLMALIERFRIVA 602
Cdd:PRK15048 462 DEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFRLAA 517
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
346-608 4.32e-56

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 199.53  E-value: 4.32e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 346 LQDTLSGIRDSAATIQRNSGAVSASAGELSKRTEAQAANLEETAAAVEEITVTVRSSAERAREANNVVAATKKTADNSGA 425
Cdd:PRK09793 259 LRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGV 338
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 426 VVGDAVAAMDRIEQASQRIEQIIEVIDDIAFQTNLLALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIE 505
Cdd:PRK09793 339 QVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKGLIE 418
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 506 TSSREVTAGSELVQKTGSVLASISQEIIAISGHVETIATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAETTQASRLLA 585
Cdd:PRK09793 419 ESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQVTQQNASLVEEAAVATEQLA 498
                        250       260
                 ....*....|....*....|....*....
gi 116250530 586 GEADTLMALIERFRI------VAESAPAH 608
Cdd:PRK09793 499 NQADHLSSRVAVFTLeehevaRHESAQLQ 527
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
400-600 2.88e-49

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 171.47  E-value: 2.88e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  400 RSSAERAREANNvvaATKKTADNSGAVVGDAVAAMDRIEQASQRIEQIIEVIDDIAFQTNLLALNAGIEAARAGEAGKGF 479
Cdd:pfam00015   1 AQASDLAQLASE---EALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGF 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  480 AVVAQEVRELAQRSADAAREIKSLIETSSR--------------EVTAGSELVQKTGSVLASISQEIIAISGHVETIATA 545
Cdd:pfam00015  78 AVVADEVRKLAERSAQAAKEIEALIEEIVKqtndstasiqqtrtEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAA 157
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 116250530  546 SRDQSAALQEVNGSVNAMDQMTQKNAAMVAETTQASRLLAGEADTLMALIERFRI 600
Cdd:pfam00015 158 SDEQSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQFRI 212
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
365-603 2.52e-05

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 46.20  E-value: 2.52e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   365 GAVSASAGELSKRTEAQ--AANLEETAAAVEEITVTVRSSAERAREANNVVAATKKTADN----SGAVVGDAVAAMDRIE 438
Cdd:TIGR02168  664 GSAKTNSSILERRREIEelEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEElsrqISALRKDLARLEAEVE 743
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   439 QASQRIEQIIEVIDDIAFQTNLLALNAGIEAARAGEAgkgfAVVAQEVRELAQRSADAAREIKSLIETSSREVTAGSELV 518
Cdd:TIGR02168  744 QLEERIAQLSKELTELEAEIEELEERLEEAEEELAEA----EAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEA 819
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   519 QKTGSVLASISQEIIAISGHVETIATASRDQSAALQEVNGSvnaMDQMTQKNAAMVAETTQASRLLAGEADTLMALIERF 598
Cdd:TIGR02168  820 ANLRERLESLERRIAATERRLEDLEEQIEELSEDIESLAAE---IEELEELIEELESELEALLNERASLEEALALLRSEL 896

                   ....*
gi 116250530   599 RIVAE 603
Cdd:TIGR02168  897 EELSE 901
PRK10935 PRK10935
nitrate/nitrite sensor protein NarQ; Provisional
189-287 2.16e-04

nitrate/nitrite sensor protein NarQ; Provisional


Pssm-ID: 236800 [Multi-domain]  Cd Length: 565  Bit Score: 42.92  E-value: 2.16e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 189 QRMYELQM-LVLGVGAIVMLIVGVLAFYAIRLS----VKPLQALTTSVHSISAGDLEGAIPCVEKRNEFGDIGRAL-ALF 262
Cdd:PRK10935 140 QHFAERKLiLLAAISLLGLILILTLVFFTVRFTrrqvVAPLNQLVTASQQIEKGQFDHIPLDTTLPNELGLLAKAFnQMS 219
                         90       100
                 ....*....|....*....|....*.
gi 116250530 263 RDSARARRDLETQAAEQ-RELSDAER 287
Cdd:PRK10935 220 SELHKLYRSLEASVEEKtRKLTQANR 245
TIGR02680 TIGR02680
TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene ...
254-440 3.32e-04

TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length [Hypothetical proteins, Conserved].


Pssm-ID: 233973 [Multi-domain]  Cd Length: 1353  Bit Score: 42.49  E-value: 3.32e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   254 DIGRALALFRDSA-------RARRDLETQAAEQRElsDAERARNDADKRSldgqidfavNQLAAGLGRLSQGDVsqtigt 326
Cdd:TIGR02680  848 AVGLALKRFGDHLhtlevavRELRHAATRAAEQRA--RAARAESDAREAA---------EDAAEARAEAEEASL------ 910
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   327 pfvgRLEQLRVDFNASLLRLQDTLSGIRDSAATIQRNSGAvsasAGELSKRTEAQAANLEETAAAVEEITVTVRSSAERA 406
Cdd:TIGR02680  911 ----RLRTLEESVGAMVDEIRARLAETRAALASGGRELPR----LAEALATAEEARGRAEEKRAEADATLDERAEARDHA 982
                          170       180       190
                   ....*....|....*....|....*....|....
gi 116250530   407 REANNVVAATKKTADNSGAVVGDAVAAMDRIEQA 440
Cdd:TIGR02680  983 IGQLREFALTGLLEDALPDTEVPELDAKWTIEAA 1016
NarQ COG3850
Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms]
193-287 5.52e-04

Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms]


Pssm-ID: 226368 [Multi-domain]  Cd Length: 574  Bit Score: 41.56  E-value: 5.52e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530 193 ELQMLVLGVGAIVMLIVGVLAFYAIRLSV-KPLQALTTSVHSISAGDLEgAIPCVEKRNEFGDIGRAL-ALFRDSARARR 270
Cdd:COG3850  147 ILLVLVQLAGMLLILLLVVFTIYWLRRRVvRPLNQLTSAAQRIGRRQFD-QRPTDTGRNELGLLGRAFnQMSGELKKLYA 225
                         90
                 ....*....|....*...
gi 116250530 271 DLETQAAEQ-RELSDAER 287
Cdd:COG3850  226 DLEQRVEEKtRDLEQKNQ 243
DUF390 pfam04094
Protein of unknown function (DUF390); This is a family of long proteins currently only found ...
272-409 1.28e-03

Protein of unknown function (DUF390); This is a family of long proteins currently only found in the rice genome. They have no known function. However they may be some kind of transposable element.


Pssm-ID: 112890 [Multi-domain]  Cd Length: 843  Bit Score: 40.57  E-value: 1.28e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  272 LETQAAEQRELsDAERARNDADKRSLDGQIDFA-------VNQLAAGLGRLSQ--GDVSQTIGTPFVGRL------EQLR 336
Cdd:pfam04094 406 MEALQAERAEL-DAAWARVEEGRRSVEAMVEAGrkahrrhTSELEARKKDLAEiaKEVEEEREAALIATTvlneaqDDLR 484
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  337 VDFN---ASLLRLQDTLSGIRDSAATIQRNSGAVSASAGELSKRTEAQAANLEETAAAVE------EITVTVRSSAERAR 407
Cdd:pfam04094 485 LQYGsraAELEKKLDAAQGVLDAAAAREQRAAENEAASRQREEALEARAMALEERACAKErdladrEAAVAIREATLAAH 564

                  ..
gi 116250530  408 EA 409
Cdd:pfam04094 565 EA 566
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
246-520 1.79e-03

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 40.08  E-value: 1.79e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  246 VEKRNEFGDIGRALALFRDSARARRDLE----TQAAEQRELSDAERARNDADK--RSLDGQIDFAVNQLAAGLGRL--SQ 317
Cdd:COG1196   657 RNKRSSLAQKRELKELEEELAELEAQLEkleeELKSLKNELRSLEDLLEELRRqlEELERQLEELKRELAALEEELeqLQ 736
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  318 GDVSQtigtpfvgrLEQLRVDFNASLLRLQDTLsgirdsaATIQRNSGAVSASAGELSKRTEAQAANLEETAAAVEEITV 397
Cdd:COG1196   737 SRLEE---------LEEELEELEEELEELQERL-------EELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEE 800
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  398 TVRSSAERAREANNVVAATKKTADNsgavvgdavaAMDRIEQASQRIEQIIEVIDDIA-----FQTNLLALNAGIEAARA 472
Cdd:COG1196   801 ELEEAERRLDALERELESLEQRRER----------LEQEIEELEEEIEELEEKLDELEeeleeLEKELEELKEELEELEA 870
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|
gi 116250530  473 --GEAGKGFAVVAQEVRELAQRSADAAREIKSLIETSSREVTAGSELVQK 520
Cdd:COG1196   871 ekEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAK 920
PHA03332 PHA03332
membrane glycoprotein; Provisional
455-605 2.61e-03

membrane glycoprotein; Provisional


Pssm-ID: 223047 [Multi-domain]  Cd Length: 1328  Bit Score: 39.57  E-value: 2.61e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530  455 AFQTNLLALNAGIEAARageagkgfavVAQEVRELAQRSADAAREIKSLIETSSREVTAGSELVQKTGSVLASISqeiia 534
Cdd:PHA03332  861 AFTMASAALNAATQALA----------VATLYVNQLLQATAATAEMASKIGGLNARVDKTSDVITKLGDTIAKIS----- 925
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 116250530  535 isghvetiATASRDqsaaLQEVNGSVNAMDQmtQKNAAMVAETTQASRLLAGEADTLMALIERFRIVAESA 605
Cdd:PHA03332  926 --------ATLDNN----IRAVNGRVSDLED--QVNLRFLAVATNFNTLATQLKELGTTTNERIEEVMAAA 982
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
246-510 4.95e-03

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 38.50  E-value: 4.95e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   246 VEKRNEFGDIGRALALFRDSARARRDLETQAAEQRELSDAERARNDADKRSLDGQIDFAVNQLAAGLGRLSQgdVSQTIG 325
Cdd:TIGR02168  715 EQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEE--LEAQIE 792
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   326 TpFVGRLEQLRVDF----------NASLLRLQDTLSGIRDSAATIQRNSGAVSASAGELSKRTEAQAANLEETAAAVEEI 395
Cdd:TIGR02168  793 Q-LKEELKALREALdelraeltllNEEAANLRERLESLERRIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEEL 871
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   396 TVTVRSSAERAREANNVVAATKKTADNSGAVVGDAVAAMDRIEQASQRIEQIIEviddiafqtnllALNAGIEAARAGEA 475
Cdd:TIGR02168  872 ESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREKLA------------QLELRLEGLEVRID 939
                          250       260       270
                   ....*....|....*....|....*....|....*
gi 116250530   476 GkgfavVAQEVRELAQRSADAAREIKSLIETSSRE 510
Cdd:TIGR02168  940 N-----LQERLSEEYSLTLEEAEALENKIEDDEEE 969
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
265-532 5.57e-03

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 38.51  E-value: 5.57e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   265 SARARRDLETQAAEQRELSDAERARNDADKRSLDGQIDFAVNQLAAGLGRLSQGDVSQTIG-----------TPFVGRLE 333
Cdd:TIGR02169  267 LEEIEQLLEELNKKIKDLGEEEQLRVKEKIGELEAEIASLERSIAEKERELEDAEERLAKLeaeidkllaeiEELEREIE 346
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   334 QLRVDFNAsllrLQDTLSGIRDSAATIQRNSGAVSASAGELSKRTEAQAANLEETAAAVEEITVTVRSSAERAREAN--- 410
Cdd:TIGR02169  347 EERKRRDK----LTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELKRELDRLQEELQRLSeel 422
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116250530   411 -NVVAATKKTADNSGAVVGDAVAAMDRIEQASQRIEQIIEVIDDIafQTNLLALNAGIEAarageagkgfavVAQEVREL 489
Cdd:TIGR02169  423 aDLNAAIAGIEAKINELEEEKEDKALEIKKQEWKLEQLAADLSKY--EQELYDLKEEYDR------------VEKELSKL 488
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....
gi 116250530   490 aQRSADAAREIKSLIETSSREVTAGSELVQKTGS-VLASISQEI 532
Cdd:TIGR02169  489 -QRELAEAEAQARASEERVRGGRAVEEVLKASIQgVHGTVAQLG 531
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH