NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|114690527|ref|XP_521314.2|]
View 

PREDICTED: melanoma-associated antigen 12 [Pan troglodytes]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MAGE pfam01454
MAGE family; The MAGE (melanoma antigen-encoding gene) family are expressed in a wide variety ...
116-286 1.11e-87

MAGE family; The MAGE (melanoma antigen-encoding gene) family are expressed in a wide variety of tumors but not in normal cells, with the exception of the male germ cells, placenta, and, possibly, cells of the developing embryo. The cellular function of this family is unknown. This family also contains the yeast protein, Nse3. The Nse3 protein is part of the Smc5-6 complex. Nse3 has been demonstrated to be important for meiosis.


:

Pssm-ID: 201804  Cd Length: 171  Bit Score: 262.51  E-value: 1.11e-87
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114690527  116 LVHFLLLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQLVFGIEVVEVVRIGHLYTLVTCLGLSYDGLLGDNQI 195
Cdd:pfam01454   1 LVRFLLSKYQKKEPITRAEILKIVIKEYKRHFPEIFKRASETLELVFGLELKEVDPKSHSYILVSKLPLSYDGSLGDDQG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114690527  196 VPKTGLLIIVLAIIAKEGDCAPEEKIWEELSVLEASDGREDSVFAHPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGP 275
Cdd:pfam01454  81 LPKTGLLMVILGVIFMKGNCASEEELWEFLNRLGLYPGEKHFIFGDPRKLITEDLVKQKYLEYRQVPNSDPPEYEFLWGP 160
                         170
                  ....*....|.
gi 114690527  276 RALVETSYVKV 286
Cdd:pfam01454 161 RALAETSKMKV 171
MAGE_N pfam12440
Melanoma associated antigen family N terminal; This domain family is found in eukaryotes, and ...
3-98 1.12e-37

Melanoma associated antigen family N terminal; This domain family is found in eukaryotes, and is typically between 82 and 96 amino acids in length. The family is found in association with pfam01454. This family is the N terminal of various melanoma associated antigens. These are tumor rejection antigens which are expressed on HLA-A1 of tumor cells and they are recognized by cytotoxic T lymphocytes (CTLs).


:

Pssm-ID: 257050  Cd Length: 96  Bit Score: 131.16  E-value: 1.12e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114690527    3 LEQRSQHCKPEEGLEAQGEALGLVGAQAPAIEEQETASSSSTLVEVTLGEVPAAESPSPPHSPQGASTLPTTINYTLWSH 82
Cdd:pfam12440   1 RGQKSKLCAREKRLQAQGETQGLEGAQAPAAEEEESPSSSSPLIPGTPESVPAAGSPSPPQSPQGASSSSTAVAATSWSQ 80
                          90
                  ....*....|....*.
gi 114690527   83 SDEGSSNEEQEGPSTF 98
Cdd:pfam12440  81 SDEGSSSQEEESPSSS 96
 
Name Accession Description Interval E-value
MAGE pfam01454
MAGE family; The MAGE (melanoma antigen-encoding gene) family are expressed in a wide variety ...
116-286 1.11e-87

MAGE family; The MAGE (melanoma antigen-encoding gene) family are expressed in a wide variety of tumors but not in normal cells, with the exception of the male germ cells, placenta, and, possibly, cells of the developing embryo. The cellular function of this family is unknown. This family also contains the yeast protein, Nse3. The Nse3 protein is part of the Smc5-6 complex. Nse3 has been demonstrated to be important for meiosis.


Pssm-ID: 201804  Cd Length: 171  Bit Score: 262.51  E-value: 1.11e-87
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114690527  116 LVHFLLLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQLVFGIEVVEVVRIGHLYTLVTCLGLSYDGLLGDNQI 195
Cdd:pfam01454   1 LVRFLLSKYQKKEPITRAEILKIVIKEYKRHFPEIFKRASETLELVFGLELKEVDPKSHSYILVSKLPLSYDGSLGDDQG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114690527  196 VPKTGLLIIVLAIIAKEGDCAPEEKIWEELSVLEASDGREDSVFAHPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGP 275
Cdd:pfam01454  81 LPKTGLLMVILGVIFMKGNCASEEELWEFLNRLGLYPGEKHFIFGDPRKLITEDLVKQKYLEYRQVPNSDPPEYEFLWGP 160
                         170
                  ....*....|.
gi 114690527  276 RALVETSYVKV 286
Cdd:pfam01454 161 RALAETSKMKV 171
MAGE_N pfam12440
Melanoma associated antigen family N terminal; This domain family is found in eukaryotes, and ...
3-98 1.12e-37

Melanoma associated antigen family N terminal; This domain family is found in eukaryotes, and is typically between 82 and 96 amino acids in length. The family is found in association with pfam01454. This family is the N terminal of various melanoma associated antigens. These are tumor rejection antigens which are expressed on HLA-A1 of tumor cells and they are recognized by cytotoxic T lymphocytes (CTLs).


Pssm-ID: 257050  Cd Length: 96  Bit Score: 131.16  E-value: 1.12e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114690527    3 LEQRSQHCKPEEGLEAQGEALGLVGAQAPAIEEQETASSSSTLVEVTLGEVPAAESPSPPHSPQGASTLPTTINYTLWSH 82
Cdd:pfam12440   1 RGQKSKLCAREKRLQAQGETQGLEGAQAPAAEEEESPSSSSPLIPGTPESVPAAGSPSPPQSPQGASSSSTAVAATSWSQ 80
                          90
                  ....*....|....*.
gi 114690527   83 SDEGSSNEEQEGPSTF 98
Cdd:pfam12440  81 SDEGSSSQEEESPSSS 96
 
Name Accession Description Interval E-value
MAGE pfam01454
MAGE family; The MAGE (melanoma antigen-encoding gene) family are expressed in a wide variety ...
116-286 1.11e-87

MAGE family; The MAGE (melanoma antigen-encoding gene) family are expressed in a wide variety of tumors but not in normal cells, with the exception of the male germ cells, placenta, and, possibly, cells of the developing embryo. The cellular function of this family is unknown. This family also contains the yeast protein, Nse3. The Nse3 protein is part of the Smc5-6 complex. Nse3 has been demonstrated to be important for meiosis.


Pssm-ID: 201804  Cd Length: 171  Bit Score: 262.51  E-value: 1.11e-87
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114690527  116 LVHFLLLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQLVFGIEVVEVVRIGHLYTLVTCLGLSYDGLLGDNQI 195
Cdd:pfam01454   1 LVRFLLSKYQKKEPITRAEILKIVIKEYKRHFPEIFKRASETLELVFGLELKEVDPKSHSYILVSKLPLSYDGSLGDDQG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114690527  196 VPKTGLLIIVLAIIAKEGDCAPEEKIWEELSVLEASDGREDSVFAHPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGP 275
Cdd:pfam01454  81 LPKTGLLMVILGVIFMKGNCASEEELWEFLNRLGLYPGEKHFIFGDPRKLITEDLVKQKYLEYRQVPNSDPPEYEFLWGP 160
                         170
                  ....*....|.
gi 114690527  276 RALVETSYVKV 286
Cdd:pfam01454 161 RALAETSKMKV 171
MAGE_N pfam12440
Melanoma associated antigen family N terminal; This domain family is found in eukaryotes, and ...
3-98 1.12e-37

Melanoma associated antigen family N terminal; This domain family is found in eukaryotes, and is typically between 82 and 96 amino acids in length. The family is found in association with pfam01454. This family is the N terminal of various melanoma associated antigens. These are tumor rejection antigens which are expressed on HLA-A1 of tumor cells and they are recognized by cytotoxic T lymphocytes (CTLs).


Pssm-ID: 257050  Cd Length: 96  Bit Score: 131.16  E-value: 1.12e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114690527    3 LEQRSQHCKPEEGLEAQGEALGLVGAQAPAIEEQETASSSSTLVEVTLGEVPAAESPSPPHSPQGASTLPTTINYTLWSH 82
Cdd:pfam12440   1 RGQKSKLCAREKRLQAQGETQGLEGAQAPAAEEEESPSSSSPLIPGTPESVPAAGSPSPPQSPQGASSSSTAVAATSWSQ 80
                          90
                  ....*....|....*.
gi 114690527   83 SDEGSSNEEQEGPSTF 98
Cdd:pfam12440  81 SDEGSSSQEEESPSSS 96
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH