NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|114051185|ref|NP_001039489|]
View 

programmed cell death protein 5 [Bos taurus]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
dsDNA_bind pfam01984
Double-stranded DNA-binding domain; This domain is believed to bind double-stranded DNA of 20 ...
9-112 3.83e-33

Double-stranded DNA-binding domain; This domain is believed to bind double-stranded DNA of 20 bases length.


:

Pssm-ID: 251015  Cd Length: 105  Bit Score: 113.41  E-value: 3.83e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114051185    9 LRKQRLAELQAKHGDPGDAAQQE-AKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSGKV 87
Cdd:pfam01984   1 IRRARLAELQQQGGGLEEQQQQEeAQQQEEAQKQAILRQILTPEARERLSRIRLVKPERAEAVENQLIQLAQSGRIRGKI 80
                          90       100
                  ....*....|....*....|....*
gi 114051185   88 SEQGLIEILEKVSQQTEKKTTVKFN 112
Cdd:pfam01984  81 TEEQLKEILEQISPQKRKKTKIKID 105
 
Name Accession Description Interval E-value
dsDNA_bind pfam01984
Double-stranded DNA-binding domain; This domain is believed to bind double-stranded DNA of 20 ...
9-112 3.83e-33

Double-stranded DNA-binding domain; This domain is believed to bind double-stranded DNA of 20 bases length.


Pssm-ID: 251015  Cd Length: 105  Bit Score: 113.41  E-value: 3.83e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114051185    9 LRKQRLAELQAKHGDPGDAAQQE-AKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSGKV 87
Cdd:pfam01984   1 IRRARLAELQQQGGGLEEQQQQEeAQQQEEAQKQAILRQILTPEARERLSRIRLVKPERAEAVENQLIQLAQSGRIRGKI 80
                          90       100
                  ....*....|....*....|....*
gi 114051185   88 SEQGLIEILEKVSQQTEKKTTVKFN 112
Cdd:pfam01984  81 TEEQLKEILEQISPQKRKKTKIKID 105
COG2118 COG2118
DNA-binding protein [General function prediction only]
1-114 1.20e-22

DNA-binding protein [General function prediction only]


Pssm-ID: 225029  Cd Length: 116  Bit Score: 86.65  E-value: 1.20e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114051185   1 MAEQELEALRKQRLAELQAKHGDPGDAAQQEAKHREAE--MRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMA 78
Cdd:COG2118    1 MDDEELEEIRRRKLAELQRQAKLEEQREAQEEQARQEEeaQKQAILRQILTPEARERLARVRLVRPELAEAVENQLIQLA 80
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 114051185  79 RYGQLSGKVSEQGLIEILEKVSQQTEKKTTVKFNRR 114
Cdd:COG2118   81 QTGRITHKIDEEELKEILERISPQTRREFKIRRRRK 116
PRK04239 PRK04239
hypothetical protein; Provisional
5-114 3.28e-16

hypothetical protein; Provisional


Pssm-ID: 179798  Cd Length: 110  Bit Score: 69.52  E-value: 3.28e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114051185   5 ELEALRKQRLAELQAKH-GDPGDAAQQEAKHREAEM-RNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQ 82
Cdd:PRK04239   2 ELEEIRRRKLEELQKQAqEQQQAQEEQEEAQAQAEAqKQAILRQILTPEARERLNRIKLVKPEFAEQVEQQLIQLAQSGR 81
                         90       100       110
                 ....*....|....*....|....*....|..
gi 114051185  83 LSGKVSEQGLIEILEKVsqqTEKKTTVKFNRR 114
Cdd:PRK04239  82 IQGPIDDEQLKEILEQL---TPQKREFKITRR 110
 
Name Accession Description Interval E-value
dsDNA_bind pfam01984
Double-stranded DNA-binding domain; This domain is believed to bind double-stranded DNA of 20 ...
9-112 3.83e-33

Double-stranded DNA-binding domain; This domain is believed to bind double-stranded DNA of 20 bases length.


Pssm-ID: 251015  Cd Length: 105  Bit Score: 113.41  E-value: 3.83e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114051185    9 LRKQRLAELQAKHGDPGDAAQQE-AKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSGKV 87
Cdd:pfam01984   1 IRRARLAELQQQGGGLEEQQQQEeAQQQEEAQKQAILRQILTPEARERLSRIRLVKPERAEAVENQLIQLAQSGRIRGKI 80
                          90       100
                  ....*....|....*....|....*
gi 114051185   88 SEQGLIEILEKVSQQTEKKTTVKFN 112
Cdd:pfam01984  81 TEEQLKEILEQISPQKRKKTKIKID 105
COG2118 COG2118
DNA-binding protein [General function prediction only]
1-114 1.20e-22

DNA-binding protein [General function prediction only]


Pssm-ID: 225029  Cd Length: 116  Bit Score: 86.65  E-value: 1.20e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114051185   1 MAEQELEALRKQRLAELQAKHGDPGDAAQQEAKHREAE--MRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMA 78
Cdd:COG2118    1 MDDEELEEIRRRKLAELQRQAKLEEQREAQEEQARQEEeaQKQAILRQILTPEARERLARVRLVRPELAEAVENQLIQLA 80
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 114051185  79 RYGQLSGKVSEQGLIEILEKVSQQTEKKTTVKFNRR 114
Cdd:COG2118   81 QTGRITHKIDEEELKEILERISPQTRREFKIRRRRK 116
PRK04239 PRK04239
hypothetical protein; Provisional
5-114 3.28e-16

hypothetical protein; Provisional


Pssm-ID: 179798  Cd Length: 110  Bit Score: 69.52  E-value: 3.28e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114051185   5 ELEALRKQRLAELQAKH-GDPGDAAQQEAKHREAEM-RNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQ 82
Cdd:PRK04239   2 ELEEIRRRKLEELQKQAqEQQQAQEEQEEAQAQAEAqKQAILRQILTPEARERLNRIKLVKPEFAEQVEQQLIQLAQSGR 81
                         90       100       110
                 ....*....|....*....|....*....|..
gi 114051185  83 LSGKVSEQGLIEILEKVsqqTEKKTTVKFNRR 114
Cdd:PRK04239  82 IQGPIDDEQLKEILEQL---TPQKREFKITRR 110
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH