NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|113682328|ref|NP_001038549|]
View 

semaphorin-3E precursor [Danio rerio]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Sema_3E cd11253
The Sema domain, a protein interacting module, of semaphorin 3E (Sema3E); Sema3E is a secreted ...
46-516 0e+00

The Sema domain, a protein interacting module, of semaphorin 3E (Sema3E); Sema3E is a secreted molecule implicated in axonal path finding and inhibition of developmental and postischemic angiogenesis. It is also highly expressed in metastatic cancer cells. Sema3E signaling, through its high affinity functional receptor Plexin D1, drives cancer cell invasiveness and metastatic spreading. Sema3E is a member of the class 3 semaphorin family of proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


:

Pssm-ID: 200514  Cd Length: 471  Bit Score: 936.20  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  46 FQAGEGRLQQYTMLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGREKPECANYIKLVQHYNST 125
Cdd:cd11253    1 FHSPFGFLDLHTMLLDEYQERLFVGGRDLLYSLSLERISANYKEIHWPSTQLQVEDCIMKGRDKPECANYIRVLHHYNRT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 126 HLLACGTGAFSPVCAYIRVSRGAEQeREFRLESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYRLGN 205
Cdd:cd11253   81 HLLACGTGAFDPVCAFIRVGRGSED-HLFQLESDKFERGRGRCPFDPNSSFISTLIGGELFVGLYSDYWGRDAAIFRTMN 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 206 H-SFIRTEVGDRQQLNEPKFVGSAVIPDNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSF 284
Cdd:cd11253  160 HlAHIRTEHDDERLLKEPKFVGSYMIPDNEDPDDNKVYFFFTEKALEAEGGNHAIYTRVGRVCANDQGGQRMLVNKWSTF 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 285 LKTRLICSVAGPNGIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHW 364
Cdd:cd11253  240 LKTRLICSVPGPNGIDTHFDELEDVFLLRTRDNKNPEIFGLFSTTSNIFKGYAICVYHMASIRAAFNGPFAHKEGPEYHW 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 365 KVYDGKVPYPRPGSCASKINGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEAEDGH 444
Cdd:cd11253  320 SVYEGKVPYPRPGSCASKVNGGHYGTTKDYPDEALRFARSHPLMYQAVKPVHKRPILVKTDGKYNLKQIAVDRVEAEDGQ 399
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 113682328 445 YNVLFIGTDNSVVLKMITIYNKEADTVEEVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQIRVHQC 516
Cdd:cd11253  400 YDVLFIGTDNGIVLKVITIYNQETETMEEVILEELQVFKVPVPIISMEISSKRQQLYIGSESGVAQIRFHQC 471
Ig_Semaphorin_classIII cd05871
Immunoglobulin (Ig)-like domain of class III semaphorin; Ig_Semaphorin_class III; ...
580-668 1.49e-35

Immunoglobulin (Ig)-like domain of class III semaphorin; Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascular endothelial growth factor receptor (VEGF)-induced angiogenesis and induces microvascular permeability. This group also includes Sema3B, -C, -D, -E, -G.


:

Pssm-ID: 143279  Cd Length: 91  Bit Score: 130.18  E-value: 1.49e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 580 ISEKLVYGVENNSTLLECRPRSLQASVTWYIEHGLD--MEEVKSDDRMIQTPHGLLLLRIMKSDAGVYVCQSTEHGFIQT 657
Cdd:cd05871    1 AEEKVVYGVENNSTFLECLPKSPQASVKWLFQRGGDqrKEEVKTEERLIHTERGLLLRSLQRSDAGVYTCTAVEHSFSQT 80
                         90
                 ....*....|.
gi 113682328 658 LLRVTLEVLEE 668
Cdd:cd05871   81 LAKYTLHVIEA 91
PSI smart00423
domain found in Plexins, Semaphorins and Integrins;
515-563 2.99e-05

domain found in Plexins, Semaphorins and Integrins;


:

Pssm-ID: 214655  Cd Length: 47  Bit Score: 42.53  E-value: 2.99e-05
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 113682328   515 QCGLYGSaCADCCLARDPYCAWDGFT--CSRYYPAGLytkrrfRRQDVRHG 563
Cdd:smart00423   1 RCSKYTS-CSECLLARDPYCAWCSSQgrCTSGERCDS------RRQNWLSG 44
 
Name Accession Description Interval E-value
Sema_3E cd11253
The Sema domain, a protein interacting module, of semaphorin 3E (Sema3E); Sema3E is a secreted ...
46-516 0e+00

The Sema domain, a protein interacting module, of semaphorin 3E (Sema3E); Sema3E is a secreted molecule implicated in axonal path finding and inhibition of developmental and postischemic angiogenesis. It is also highly expressed in metastatic cancer cells. Sema3E signaling, through its high affinity functional receptor Plexin D1, drives cancer cell invasiveness and metastatic spreading. Sema3E is a member of the class 3 semaphorin family of proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200514  Cd Length: 471  Bit Score: 936.20  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  46 FQAGEGRLQQYTMLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGREKPECANYIKLVQHYNST 125
Cdd:cd11253    1 FHSPFGFLDLHTMLLDEYQERLFVGGRDLLYSLSLERISANYKEIHWPSTQLQVEDCIMKGRDKPECANYIRVLHHYNRT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 126 HLLACGTGAFSPVCAYIRVSRGAEQeREFRLESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYRLGN 205
Cdd:cd11253   81 HLLACGTGAFDPVCAFIRVGRGSED-HLFQLESDKFERGRGRCPFDPNSSFISTLIGGELFVGLYSDYWGRDAAIFRTMN 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 206 H-SFIRTEVGDRQQLNEPKFVGSAVIPDNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSF 284
Cdd:cd11253  160 HlAHIRTEHDDERLLKEPKFVGSYMIPDNEDPDDNKVYFFFTEKALEAEGGNHAIYTRVGRVCANDQGGQRMLVNKWSTF 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 285 LKTRLICSVAGPNGIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHW 364
Cdd:cd11253  240 LKTRLICSVPGPNGIDTHFDELEDVFLLRTRDNKNPEIFGLFSTTSNIFKGYAICVYHMASIRAAFNGPFAHKEGPEYHW 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 365 KVYDGKVPYPRPGSCASKINGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEAEDGH 444
Cdd:cd11253  320 SVYEGKVPYPRPGSCASKVNGGHYGTTKDYPDEALRFARSHPLMYQAVKPVHKRPILVKTDGKYNLKQIAVDRVEAEDGQ 399
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 113682328 445 YNVLFIGTDNSVVLKMITIYNKEADTVEEVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQIRVHQC 516
Cdd:cd11253  400 YDVLFIGTDNGIVLKVITIYNQETETMEEVILEELQVFKVPVPIISMEISSKRQQLYIGSESGVAQIRFHQC 471
Ig_Semaphorin_classIII cd05871
Immunoglobulin (Ig)-like domain of class III semaphorin; Ig_Semaphorin_class III; ...
580-668 1.49e-35

Immunoglobulin (Ig)-like domain of class III semaphorin; Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascular endothelial growth factor receptor (VEGF)-induced angiogenesis and induces microvascular permeability. This group also includes Sema3B, -C, -D, -E, -G.


Pssm-ID: 143279  Cd Length: 91  Bit Score: 130.18  E-value: 1.49e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 580 ISEKLVYGVENNSTLLECRPRSLQASVTWYIEHGLD--MEEVKSDDRMIQTPHGLLLLRIMKSDAGVYVCQSTEHGFIQT 657
Cdd:cd05871    1 AEEKVVYGVENNSTFLECLPKSPQASVKWLFQRGGDqrKEEVKTEERLIHTERGLLLRSLQRSDAGVYTCTAVEHSFSQT 80
                         90
                 ....*....|.
gi 113682328 658 LLRVTLEVLEE 668
Cdd:cd05871   81 LAKYTLHVIEA 91
Sema pfam01403
Sema domain; The Sema domain occurs in semaphorins, which are a large family of secreted and ...
57-497 1.61e-178

Sema domain; The Sema domain occurs in semaphorins, which are a large family of secreted and transmembrane proteins, some of which function as repellent signals during axon guidance. Sema domains also occur in the hepatocyte growth factor receptor and human plexin A-3.


Pssm-ID: 250593  Cd Length: 434  Bit Score: 521.51  E-value: 1.61e-178
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328   57 TMLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGR-EKPECANYIKLVQHYNSTHLLACGTGAF 135
Cdd:pfam01403   3 TLLLDEDRSRLYVGARNHVYVLNLEDLSERQLKIGWPSSCETCEECYMKGKsPGTECQNFIRVLQDYNDTHLYVCGTNAF 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  136 SPVCAYIRVSrgaEQEREFRLESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGNHSFIRTEVG 214
Cdd:pfam01403  83 QPVCTLINLG---DRDCLFSLDVENEEDGCGDCPYDPLGNSTSVLVDGELYSGTVADFSGRDPSIRRlLGSHDGLRTEFH 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  215 DRQQLNEPKFVGSAVIPDNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSFLKTRLICSVA 294
Cdd:pfam01403 160 DSKWLNEPNFVDSYPIHYVHSFSDDFVYFFFREPAVEDSNCGKAIHSRVARVCKNDPGGRRYLENKWTTFLKARLNCSVP 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  295 GpNGIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWKVYDGKVPYP 374
Cdd:pfam01403 240 G-GEIPFYFNELQAAFVLPSGANRDPVLYGVFTTSSNSSAGSAVCAFPMSDINAVFNGPFKHQESPNSQWLPYRGKVPYP 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  375 RPGSCASkingghfSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEAEDGHYNVLFIGTDN 454
Cdd:pfam01403 319 RPGQCPN-------DSNGDLPDDTLNFARCHPLMDEVVPPVHRVPLFVGQSVNYRLTSIAVDRVRAGDGQYTVLFLGTDD 391
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|...
gi 113682328  455 SVVLKMITIYNKEADTVEEVLLEELQVFKVPVPITEILISTKR 497
Cdd:pfam01403 392 GRVLKVVVLSRSSSASYEEVVLEESQVFPDGAPVQRLEISSKN 434
Sema smart00630
semaphorin domain;
57-488 2.93e-131

semaphorin domain;


Pssm-ID: 214747  Cd Length: 390  Bit Score: 398.28  E-value: 2.93e-131
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328    57 TMLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGREKP-ECANYIKLVQHYNSTHLLACGTGAF 135
Cdd:smart00630   3 HLLLDEDNGTLYVGARNRLYQLSLNLILEAELKTGPVLSSPDCEECVSKGKDPPtDCVNYIRLLLDYNEDRLLVCGTNAF 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328   136 SPVCAYIRVsrgaeqerefrlesdhiesgrgrvpfhpnsplastvyrGELFVGLYTDYWENDAALYRLG--------NHS 207
Cdd:smart00630  83 QPVCRLRNL--------------------------------------GELYVGTVADFSGSDPAIPRSLsvrrlkgtSGV 124
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328   208 FIRTEVGDRQQLNEPKFVGSAVIpdnddpaDDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSFLKT 287
Cdd:smart00630 125 SLRTVLYDSKWLNEPNFVYAFES-------GDFVYFFFRETAVEDDNCGKAVHSRVARVCKNDVGGPRSLDKKWTSFLKA 197
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328   288 RLICSVAGPngIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWKVY 367
Cdd:smart00630 198 RLECSVPGE--DPFYFNELQAAFLLPPGSESDDVLYGVFSTSSNPIPGSAVCAFSLSDINAVFNGPFKECETSTSQWLPY 275
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328   368 -DGKVPYPRPGSCASKIngghfSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVeAEDGHYN 446
Cdd:smart00630 276 sRGKVPYPRPGTCPNKP-----PSSKDLPDETLNFIKSHPLMDEVVQPLTGRPLFVKTDSNYLLTSIAVDRV-ATDGNYT 349
                          410       420       430       440
                   ....*....|....*....|....*....|....*....|..
gi 113682328   447 VLFIGTDNSVVLKMITIYNkeADTVEEVLLEELQVFKVPVPI 488
Cdd:smart00630 350 VLFLGTSDGRILKVVLSES--SSSSESVVLEEISVFPDGSPI 389
PSI smart00423
domain found in Plexins, Semaphorins and Integrins;
515-563 2.99e-05

domain found in Plexins, Semaphorins and Integrins;


Pssm-ID: 214655  Cd Length: 47  Bit Score: 42.53  E-value: 2.99e-05
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 113682328   515 QCGLYGSaCADCCLARDPYCAWDGFT--CSRYYPAGLytkrrfRRQDVRHG 563
Cdd:smart00423   1 RCSKYTS-CSECLLARDPYCAWCSSQgrCTSGERCDS------RRQNWLSG 44
PSI pfam01437
Plexin repeat; A cysteine rich repeat found in several different extracellular receptors. The ...
516-543 2.17e-03

Plexin repeat; A cysteine rich repeat found in several different extracellular receptors. The function of the repeat is unknown. Three copies of the repeat are found Plexin. Two copies of the repeat are found in mahogany protein. A related C. elegans protein contains four copies of the repeat. The Met receptor contains a single copy of the repeat. The Pfam alignment shows 6 conserved cysteine residues that may form three conserved disulphide bridges, whereas shows 8 conserved cysteines. The pattern of conservation suggests that cysteines 5 and 7 (that are not absolutely conserved) form a disulphide bridge (Personal observation. A Bateman).


Pssm-ID: 250622  Cd Length: 48  Bit Score: 37.14  E-value: 2.17e-03
                          10        20        30
                  ....*....|....*....|....*....|
gi 113682328  516 CGLYGSaCADCCLARDPYCAWDG--FTCSR 543
Cdd:pfam01437   2 CSQYTS-CSSCLAARDPYCGWCSseGRCTR 30
 
Name Accession Description Interval E-value
Sema_3E cd11253
The Sema domain, a protein interacting module, of semaphorin 3E (Sema3E); Sema3E is a secreted ...
46-516 0e+00

The Sema domain, a protein interacting module, of semaphorin 3E (Sema3E); Sema3E is a secreted molecule implicated in axonal path finding and inhibition of developmental and postischemic angiogenesis. It is also highly expressed in metastatic cancer cells. Sema3E signaling, through its high affinity functional receptor Plexin D1, drives cancer cell invasiveness and metastatic spreading. Sema3E is a member of the class 3 semaphorin family of proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200514  Cd Length: 471  Bit Score: 936.20  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  46 FQAGEGRLQQYTMLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGREKPECANYIKLVQHYNST 125
Cdd:cd11253    1 FHSPFGFLDLHTMLLDEYQERLFVGGRDLLYSLSLERISANYKEIHWPSTQLQVEDCIMKGRDKPECANYIRVLHHYNRT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 126 HLLACGTGAFSPVCAYIRVSRGAEQeREFRLESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYRLGN 205
Cdd:cd11253   81 HLLACGTGAFDPVCAFIRVGRGSED-HLFQLESDKFERGRGRCPFDPNSSFISTLIGGELFVGLYSDYWGRDAAIFRTMN 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 206 H-SFIRTEVGDRQQLNEPKFVGSAVIPDNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSF 284
Cdd:cd11253  160 HlAHIRTEHDDERLLKEPKFVGSYMIPDNEDPDDNKVYFFFTEKALEAEGGNHAIYTRVGRVCANDQGGQRMLVNKWSTF 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 285 LKTRLICSVAGPNGIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHW 364
Cdd:cd11253  240 LKTRLICSVPGPNGIDTHFDELEDVFLLRTRDNKNPEIFGLFSTTSNIFKGYAICVYHMASIRAAFNGPFAHKEGPEYHW 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 365 KVYDGKVPYPRPGSCASKINGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEAEDGH 444
Cdd:cd11253  320 SVYEGKVPYPRPGSCASKVNGGHYGTTKDYPDEALRFARSHPLMYQAVKPVHKRPILVKTDGKYNLKQIAVDRVEAEDGQ 399
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 113682328 445 YNVLFIGTDNSVVLKMITIYNKEADTVEEVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQIRVHQC 516
Cdd:cd11253  400 YDVLFIGTDNGIVLKVITIYNQETETMEEVILEELQVFKVPVPIISMEISSKRQQLYIGSESGVAQIRFHQC 471
Ig_Semaphorin_classIII cd05871
Immunoglobulin (Ig)-like domain of class III semaphorin; Ig_Semaphorin_class III; ...
580-668 1.49e-35

Immunoglobulin (Ig)-like domain of class III semaphorin; Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascular endothelial growth factor receptor (VEGF)-induced angiogenesis and induces microvascular permeability. This group also includes Sema3B, -C, -D, -E, -G.


Pssm-ID: 143279  Cd Length: 91  Bit Score: 130.18  E-value: 1.49e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 580 ISEKLVYGVENNSTLLECRPRSLQASVTWYIEHGLD--MEEVKSDDRMIQTPHGLLLLRIMKSDAGVYVCQSTEHGFIQT 657
Cdd:cd05871    1 AEEKVVYGVENNSTFLECLPKSPQASVKWLFQRGGDqrKEEVKTEERLIHTERGLLLRSLQRSDAGVYTCTAVEHSFSQT 80
                         90
                 ....*....|.
gi 113682328 658 LLRVTLEVLEE 668
Cdd:cd05871   81 LAKYTLHVIEA 91
Sema_3 cd11239
The Sema domain, a protein interacting module, of class 3 semaphorins; Class 3 semaphorins ...
46-516 0e+00

The Sema domain, a protein interacting module, of class 3 semaphorins; Class 3 semaphorins (Sema3s) are secreted regulator molecules involved in the development of the nervous system, vasculogenesis, angiogenesis,and tumorigenesis. There are 7 distinct subfamilies named Sema3A to 3G. Sema3s function as repellent signals during axon guidance by repelling neurons away from the source of Sema3s. However, Sema3s that are secreted by tumor cells play an inhibitory role in tumor growth and angiogenesis (specifically Sema3B and Sema3F). Sema3s functions by forming complexes with neuropilins and A-type plexins, where neuropilins serve as the ligand binding moiety and the plexins function as signal transduction component. Sema3s primarily inhibit the cell motility and migration of tumor and endothelial cells by inducing collapse of the actin cytoskeleton via neuropilins and plexins. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200500 [Multi-domain]  Cd Length: 471  Bit Score: 721.07  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  46 FQAGEGRLQQYTMLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGRE-KPECANYIKLVQHYNS 124
Cdd:cd11239    1 FLGSMNSLDYRSLLLDEDRDRLYVGGKDHILSLSLDNINQDPKKIYWPASPERIEECKMAGKDpNTECANFVRVLQPYNR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 125 THLLACGTGAFSPVCAYIRVSRGAEqEREFRLESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-L 203
Cdd:cd11239   81 THLYACGTGAFHPICAFINVGRRLE-DPIFKLDDSSLESGRGKCPFDPNQPFASVLIDGELYSGTAIDFMGRDAAIFRsL 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 204 GNHSFIRTEVGDRQQLNEPKFVGSAVIPDNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSS 283
Cdd:cd11239  160 GHRHYIRTEQYDSRWLNEPKFVGAYLIPDSDNPDDDKVYFFFREKAVEAEGSGKAIYSRVGRICKNDVGGQRSLVNKWST 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 284 FLKTRLICSVAGPNGIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHH 363
Cdd:cd11239  240 FLKARLVCSVPGPDGIDTYFDELEDVFLLPTRDPKNPLIYGVFTTSSNVFKGSAVCVYSMADIRAAFNGPFAHKEGPNYQ 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 364 WKVYDGKVPYPRPGSCASKINGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEAEDG 443
Cdd:cd11239  320 WVEYQGKVPYPRPGTCPSKTYGPLYKSTKDFPDDVISFARSHPLMYNPVYPLHGRPLLIRTNVPYRLTQIAVDRVEAEDG 399
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 113682328 444 HYNVLFIGTDNSVVLKMITIYNKEADTvEEVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQIRVHQC 516
Cdd:cd11239  400 QYDVLFIGTDSGTVLKVVSLPKENWEM-EEVILEELQVFKHPSPITSMEISSKRQQLYVGSAEGVVQLPLHRC 471
Sema_3G cd11255
The Sema domain, a protein interacting module, of semaphorin 3G (Sema3G); Semaphorin 3G is ...
46-516 0e+00

The Sema domain, a protein interacting module, of semaphorin 3G (Sema3G); Semaphorin 3G is identified as a primarily endothelial cell- expressed class 3 semaphorin that controls endothelial and smooth muscle cell functions in autocrine and paracrine manners, respectively. It is mainly expressed in the lung and kidney, and a little in the brain. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200516  Cd Length: 474  Bit Score: 621.16  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  46 FQAGEGRLQQYTMLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGRE-KPECANYIKLVQHYNS 124
Cdd:cd11255    1 FLGLHGDLHLSAVYLDEYRDRLFLGGKDVLYSLRLDQTHPDAKEIHWPPLPGQREECIRKGKDpETECANFVRVLQPFNR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 125 THLLACGTGAFSPVCAYIRVsrGAEQEREFRLESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-L 203
Cdd:cd11255   81 THLLACGTGAFQPVCALINV--GHRGEHVFSLDPTTVESGRGRCPHEPKRPFASTFTGGELYTGLTADFLGRDSVIFRgF 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 204 GNHSFIRTEVgDRQQLNEPKFVGSAVIPDNDDPADDKVYYFFTERVADVEGG-NKAVYTRVARVCANDQGGQRMLVNRWS 282
Cdd:cd11255  159 GTRSPLRTET-DQRLLHEPRFVAAHLIPDNADRDNDKVYFFFTERATETAEDdDGAIHSRVGRLCANDAGGQRVLVNKWS 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 283 SFLKTRLICSVAGPNGIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDH 362
Cdd:cd11255  238 TFIKARLVCSVPGPHGIQTHFDQLEDVFLLRTKDGKSPEIYALFSTISNVFQGFAVCVYSMADIWEVFNGPFAHKDGPDH 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 363 HWKVYDGKVPYPRPGSCASKIN---GGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVE 439
Cdd:cd11255  318 QWGPYEGKVPYPRPGVCPSKITaqpGRAFRSTKDYPDEVLQFARAHPLMWRPVYPSHRRPVLVKTGLPYRLTQIVVDRVE 397
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 113682328 440 AEDGHYNVLFIGTDNSVVLKMITIYNKEADTVEEVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQIRVHQC 516
Cdd:cd11255  398 AEDGYYDVMFIGTDSGSVLKVIVLQKGNSAAGEEVTLEELQVFKVPTPITEMEISVKRQMLYVGSRTGVAQVPLHRC 474
Sema_3A cd11249
The Sema domain, a protein interacting module, of semaphorin 3A (Sema3A); Sema3A has been ...
24-516 0e+00

The Sema domain, a protein interacting module, of semaphorin 3A (Sema3A); Sema3A has been reported to inhibit the growth of certain experimental tumors and to regulate endothelial cell migration and apoptosis in vitro, as well as arteriogenesis in the muscle, skin vessel permeability, and tumor angiogenesis in vivo. The function of Sema3A is mediated through receptors neuropilin-1 (NP1) and plexins, although little is known about the requirement of specific plexins in its receptor complex. It is known however that Plexin-A4 is the receptor for Sema3A in the Toll-like receptor- and sepsis-induced cytokine storm during immune response. Sema3A is a member of the Class 3 semaphorin family of secreted proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200510  Cd Length: 493  Bit Score: 566.17  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  24 KSVYPRLRLSHKELWELNRTWVFQAGEGRLQQYTMLLDETQERLIIGGKDVLYSLNLERITApHKRIVWSSSQEQVEDCL 103
Cdd:cd11249    1 KNNVPRLKLSYKEMLESNNLITFNGLANSSSYHTFLLDEERGRLYVGAKDHIFSFNLVNIKD-FQKIVWPVSPSRRDECK 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 104 MQGRE-KPECANYIKLVQHYNSTHLLACGTGAFSPVCAYIRVSRGAEqEREFRLESDHIESGRGRVPFHPNSPLASTVYR 182
Cdd:cd11249   80 WAGKDiLKECANFIKVLKAYNQTHLYACGTGAFHPVCTYIEVGHHPE-DNIFRLEDSHFENGRGKSPYDPKLLTASLLID 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 183 GELFVGLYTDYWENDAALYR-LGNHSFIRTEVGDRQQLNEPKFVGSAVIPDNDDPADDKVYYFFTERVADVEGGNKAVYT 261
Cdd:cd11249  159 GELYSGTAADFMGRDFAIFRtLGHHHPIRTEQHDSRWLNDPRFISAHLIPESDNPEDDKIYFFFRENAIDGEHTGKATHA 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 262 RVARVCANDQGGQRMLVNRWSSFLKTRLICSVAGPNGIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMY 341
Cdd:cd11249  239 RIGQLCKNDFGGHRSLVNKWTTFLKARLICSVPGPNGIDTHFDELQDVFLMNSKDPKNPIVYAVFTTSSNIFKGSAVCMY 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 342 NMDDIRAAFNGPFAHRERTDHHWKVYDGKVPYPRPGSCASKINGGhFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPIL 421
Cdd:cd11249  319 SMTDIRRVFLGPYAHRDGPNYQWVPFQGRVPYPRPGTCPSKTFGG-FDSTKDLPDDVITFARSHPAMYNPVFPINNRPII 397
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 422 LDTEGGRKLTQLAVDRVEAEDGHYNVLFIGTDNSVVLKMITIYNKEADTVEEVLLEELQVFKVPVPITEILISTKRQQLY 501
Cdd:cd11249  398 IKTDVDYQFTQIVVDRVEAEDGQYDVMFIGTDMGTVLKVVSIPKETWHDLEEVLLEEMTVFREPTAISAMELSTKQQQLY 477
                        490
                 ....*....|....*
gi 113682328 502 VGSELGVTQIRVHQC 516
Cdd:cd11249  478 IGSAIGVSQLPLHRC 492
Sema_3F cd11254
The Sema domain, a protein interacting module, of semaphorin 3F (Sema3F); Sema3F is ...
58-516 0e+00

The Sema domain, a protein interacting module, of semaphorin 3F (Sema3F); Sema3F is coexpressed with semaphorin3B. Both Sema3B and Sema3F proteins are candidate tumor suppressors that are down-regulated in highly metastatic tumors. Two receptor families, the neuropilins and plexins, have been implicated in mediating the actions of semaphorins 3B and 3F. Sema3F is a member of the class 3 semaphorin family of proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200515 [Multi-domain]  Cd Length: 470  Bit Score: 554.05  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  58 MLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGREKP-ECANYIKLVQHYNSTHLLACGTGAFS 136
Cdd:cd11254   13 LLKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWPASPQRIEECILSGKGSNgECGNFIRLIQPWNRTHLYVCGTGAYN 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 137 PVCAYIRVSRGAeQEREFRLESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGNHSFIRTEVGD 215
Cdd:cd11254   93 PVCAYINRGRRA-EDYMFRLEPDKLESGKGKCPYDPKQDSVSALINGELYAGVYIDFMGTDAAIFRtMGKQPAMRTDQYN 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 216 RQQLNEPKFVGSAVIPDNDDPADDKVYYFFTERVADVEGGnKAVYTRVARVCANDQGGQRMLVNRWSSFLKTRLICSVAG 295
Cdd:cd11254  172 SRWLNDPAFVHAHLIPDSSEKNDDKLYFFFREKSLEAPQS-PAVLSRIGRVCLNDDGGHCCLVNKWSTFLKARLVCSVPG 250
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 296 PNGIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWKVYDGKVPYPR 375
Cdd:cd11254  251 ADGIETHFDELRDVFIQPTQDTKNPVIYAVFSTSGSVFKGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPYTGKIPYPR 330
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 376 PGSCAskinGGHFS----SSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEAEDGHYNVLFIG 451
Cdd:cd11254  331 PGTCP----GGTFTpsmkSTKDYPDEVINFMRTHPLMYNAVYPVHRRPLVVRTNVNYRFTTIAVDQVDAADGRYEVLFLG 406
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 113682328 452 TDNSVVLKMItIYNKEADTVEEVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQIRVHQC 516
Cdd:cd11254  407 TDRGTVQKVI-VLPKDDLETEELTLEEVEVFKVPAPIKTMKISSKRQQLYVSSAVGVTHLSLHRC 470
Sema_3D cd11252
The Sema domain, a protein interacting module, of semaphorin 3D (Sema3D); Sema3D is a secreted ...
50-516 0e+00

The Sema domain, a protein interacting module, of semaphorin 3D (Sema3D); Sema3D is a secreted semaphorin expressed during the development of the nervous system. In zebrafish, Sema3D is expressed in the ventral tectum. It guides retinal axons along the dorsoventral axis of the tectum and guides the laterality of retinal ganglion cell (RGC) projections. Both Sema3D knockdown or its ubiquitous overexpression induced aberrant ipsilateral projections. Proper balance of Sema3D is needed at the midline for the progression of RGC axons from the chiasm midline into the contralateral optic tract. Sema3D is a member of the class 3 semaphorin family of proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200513 [Multi-domain]  Cd Length: 474  Bit Score: 546.43  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  50 EGRLQQyTMLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGREK-PECANYIKLVQHYNSTHLL 128
Cdd:cd11252    6 EGLDFQ-TLLLDEERGRLLLGAKDHIYLLDLVDLNKNPKKIYWPAAKERVELCKLAGKDAnTECANFIRVLHPYNRTHVY 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 129 ACGTGAFSPVCAYIRVSrGAEQEREFRLESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LG--- 204
Cdd:cd11252   85 VCGTGAFHPTCGYIELG-THKEDRIFLLDTQNLESGRLKCPFDPQQPFASVMTDEYLYAGTASDFLGKDTTFTRsLGptp 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 205 NHSFIRTEVGDRQQLNEPKFVGSAVIPDNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSF 284
Cdd:cd11252  164 DHHYIRTDISEHYWLNGAKFIGTFPIPDTYNPDDDKIYFFFREASQDGSTSDKSVLSRVGRVCKNDVGGQRSLINKWTTF 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 285 LKTRLICSVAGPNGIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHW 364
Cdd:cd11252  244 LKARLVCSIPGPDGADTHFDELQDIFLLPTRDERNPVVYGVFTTTSSIFKGSAVCVYSMADIRAVFNGPYAHKESPDHRW 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 365 KVYDGKVPYPRPGSCASKINGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEAEDGH 444
Cdd:cd11252  324 VQYEGRIPYPRPGTCPSKTYDPLIKSTKDFPDEVISFIKRHPLMYKSVYPLTGGPVFTRINVDYRLTQIVVDHVAAEDGQ 403
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 113682328 445 YNVLFIGTDNSVVLKMITIyNKEADTVEEVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQIRVHQC 516
Cdd:cd11252  404 YDVMFLGTDIGTVLKVVSI-TKEKWTMEEVVLEELQIFKHPSPILNMELSLKQQQLYIGSRDGLVQLSLHRC 474
Sema_3B cd11250
The Sema domain, a protein interacting module, of semaphorin 3B (Sema3B); Sema3B is ...
38-516 0e+00

The Sema domain, a protein interacting module, of semaphorin 3B (Sema3B); Sema3B is coexpressed with semaphorin 3F and both proteins are candidate tumor suppressors. Both Sema3B and Sema3F show high levels of expression in normal tissues and low-grade tumors but are down-regulated in highly metastatic tumors in the lung, melanoma cells, bladder carcinoma cells and prostate carcinoma. They are upregulated by estrogen and inhibit cell motility and invasiveness through decreased FAK phosphorylation and inhibition of MMP-2 and MMP-9 expression. Two receptor families, the neuropilins (NP) and plexins, have been implicated in mediating the actions of semaphorins 3B and 3F. Sema3B is a member of the class 3 semaphorin family of proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200511  Cd Length: 471  Bit Score: 535.65  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  38 WELNRTWVFQAgegrlqqytMLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGRE-KPECANYI 116
Cdd:cd11250    2 FDLERSCCYDA---------LLLDEERGRLFVGAKNYLASLSLDNISKQEKKIYWPAPVEWREECNWAGKDiNTDCMNYV 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 117 KLVQHYNSTHLLACGTGAFSPVCAYIRVSRGAEqEREFRLESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWEN 196
Cdd:cd11250   73 KILHHYNRTHLYACGTGAFHPTCAFVEVGQRME-DHVFRLDPSRVEDGKGKSPYDPRHTAASVLVGDELYSGVATDLMGR 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 197 DAALYR-LGNHSFIRTEVGDRQQLNEPKFVGSAVIPDNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQR 275
Cdd:cd11250  152 DFTIFRsLGQRPSLRTEQHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETAVEAAGLGKQSYSRIGQICRNDMGGQR 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 276 MLVNRWSSFLKTRLICSVAGPNGIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFA 355
Cdd:cd11250  232 SLVNKWTTFLKARLVCSVPGNEGGDTHFDELRDVFLLQTRDKRNPLIYAVFSTSSSVFQGSAVCVYTMNDVRRAFLGPFA 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 356 HRERTDHHWKVYDGKVPYPRPGSCASKiNGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAV 435
Cdd:cd11250  312 HKEGPNYQWVSYQGKVPYPRPGMCPSK-TFGSFESTKDFPDDVIQFARNHPLMFNPVLPLGGRPLFLRTGIPYTFTQIAV 390
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 436 DRVEAEDGHYNVLFIGTDNSVVLKMITIYNKEADTVEEVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQIRVHQ 515
Cdd:cd11250  391 DRVAAADGHYDVMFIGTDVGSVLKVISVPKGSWPSNEELLLEELHVFKDSSPITSMQISSKRQQLYVGSRSGVSQLPLHR 470

                 .
gi 113682328 516 C 516
Cdd:cd11250  471 C 471
Sema pfam01403
Sema domain; The Sema domain occurs in semaphorins, which are a large family of secreted and ...
57-497 1.61e-178

Sema domain; The Sema domain occurs in semaphorins, which are a large family of secreted and transmembrane proteins, some of which function as repellent signals during axon guidance. Sema domains also occur in the hepatocyte growth factor receptor and human plexin A-3.


Pssm-ID: 250593  Cd Length: 434  Bit Score: 521.51  E-value: 1.61e-178
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328   57 TMLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGR-EKPECANYIKLVQHYNSTHLLACGTGAF 135
Cdd:pfam01403   3 TLLLDEDRSRLYVGARNHVYVLNLEDLSERQLKIGWPSSCETCEECYMKGKsPGTECQNFIRVLQDYNDTHLYVCGTNAF 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  136 SPVCAYIRVSrgaEQEREFRLESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGNHSFIRTEVG 214
Cdd:pfam01403  83 QPVCTLINLG---DRDCLFSLDVENEEDGCGDCPYDPLGNSTSVLVDGELYSGTVADFSGRDPSIRRlLGSHDGLRTEFH 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  215 DRQQLNEPKFVGSAVIPDNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSFLKTRLICSVA 294
Cdd:pfam01403 160 DSKWLNEPNFVDSYPIHYVHSFSDDFVYFFFREPAVEDSNCGKAIHSRVARVCKNDPGGRRYLENKWTTFLKARLNCSVP 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  295 GpNGIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWKVYDGKVPYP 374
Cdd:pfam01403 240 G-GEIPFYFNELQAAFVLPSGANRDPVLYGVFTTSSNSSAGSAVCAFPMSDINAVFNGPFKHQESPNSQWLPYRGKVPYP 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  375 RPGSCASkingghfSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEAEDGHYNVLFIGTDN 454
Cdd:pfam01403 319 RPGQCPN-------DSNGDLPDDTLNFARCHPLMDEVVPPVHRVPLFVGQSVNYRLTSIAVDRVRAGDGQYTVLFLGTDD 391
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|...
gi 113682328  455 SVVLKMITIYNKEADTVEEVLLEELQVFKVPVPITEILISTKR 497
Cdd:pfam01403 392 GRVLKVVVLSRSSSASYEEVVLEESQVFPDGAPVQRLEISSKN 434
Sema_3C cd11251
The Sema domain, a protein interacting module, of semaphorin 3C (Sema3C); Sema3C is a secreted ...
58-516 6.43e-171

The Sema domain, a protein interacting module, of semaphorin 3C (Sema3C); Sema3C is a secreted semaphorin expressed in and adjacent to cardiac neural crest cells, and causes impaired migration of neural crest cells to the developing cardiac outflow tract, resulting in the interruption of the aortic arch and persistent truncus arteriosus. It has been proposed that Sema3C acts as a guidance molecule, regulating migration of neural crest cells that express semaphorin receptors such as plexin A2. Sema3C may also participate in tumor progression. The cleavage of Sema3C induced by ADAMTS1 promotes the migration of breast cancer cells. Sema3C is a member of the class 3 semaphorin family of secreted proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200512 [Multi-domain]  Cd Length: 470  Bit Score: 503.65  E-value: 6.43e-171
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  58 MLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGREKPE-CANYIKLVQHYNSTHLLACGTGAFS 136
Cdd:cd11251   13 LFMDEDQDRIYVGSKDHILSLNINNISQDALSIFWPASASKVEECKMAGKDPTHgCGNFVRVIQPYNRTHLYVCGSGAFS 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 137 PVCAYIRVSRGAEqEREFRLESdHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGNHSFIRTEVGD 215
Cdd:cd11251   93 PVCVYVNRGRRSE-EQVFHIDS-KAESGKGRCSFNPNVNTVSVMINEELFSGMYIDFMGTDAAIFRsLTKRNAVRTDQHN 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 216 RQQLNEPKFVGSAVIPDNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSFLKTRLICSVAG 295
Cdd:cd11251  171 SKWLSEPIFVDAHLIPDGTDPNDAKLYFFLKERLTDNSGSTKQIHSMIARVCPNDTGGQRSLVNKWTTFLKARLVCSVMD 250
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 296 PNGIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWKVYDGKVPYPR 375
Cdd:cd11251  251 EDGTETHFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHMSDIQTVFNGPFAHKEGPNHQLIAYQGRIPYPR 330
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 376 PGSCASKINGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEAEDGHYNVLFIGTDNS 455
Cdd:cd11251  331 PGTCPGGAFTPNMQSTKEFPDDVVTFIRNHPLMFNPIYPIGRRPLLVRTGTDYKYTKIAVDRVNAADGRYHVLFLGTDKG 410
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 113682328 456 VVLKMITI-YNKEADtvEEVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQIRVHQC 516
Cdd:cd11251  411 TVQKVVVLpTNGSLS--GELILEELEVFKNHAPITNMKISSKKQQLYVSSEEGISQVSLHRC 470
Sema_semaphorin cd11235
The Sema domain, a protein interacting module, of semaphorins; Semaphorins are regulator ...
57-514 2.20e-145

The Sema domain, a protein interacting module, of semaphorins; Semaphorins are regulator molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. They can be divided into 7 classes. Vertebrates have members in classes 3-7, whereas classes 1 and 2 are known only in invertebrates. Class 2 and 3 semaphorins are secreted proteins; classes 1 and 4 through 6 are transmembrane proteins; and class 7 is membrane associated via glycosylphosphatidylinositol (GPI) linkage. The semaphorins exert their function through their receptors, the neuropilin and plexin families. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200496  Cd Length: 437  Bit Score: 436.46  E-value: 2.20e-145
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  57 TMLLDETQERLIIGGKDVLYSLNLERITAPHKrIVWSSSQEQVEDCLMQGREKPECANYIKLVQHYNSTHLLACGTGAFS 136
Cdd:cd11235    5 TKLLHEDRSTLYVGARDRVYLVDLDSLYTEQK-VAWPSSPDDVDTCYLKGKSKDDCRNFIKVLEKNSDDSLLVCGTNAFN 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 137 PVCAYIRVSRGAEQErefrlesdHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGNHSFIRTEVGD 215
Cdd:cd11235   84 PSCRNYNVETFELVG--------KEESGRGKCPYDPDHNSTALFADGELYSGTSADFLGTDPVIYRtLGHNPPLRTEYHD 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 216 RQQLNEPKFVGSAVIPDnddpaddKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSFLKTRLICSVAG 295
Cdd:cd11235  156 SKWLNEPQFVGAFDIGD-------YVYFFFREIAVEYINCGKAVYSRVARVCKNDQGGSRSLEKKWTTFLKARLNCSVPG 228
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 296 pnGIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHW-KVYDGKVPYP 374
Cdd:cd11235  229 --EFPFYFNELQDVFDLPSPSNKEKIFYAVFTTPYNSIPGSAVCAYSLSDIEAVFNGPFKEQHSSNSAWlPVPDERVPEP 306
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 375 RPGSCaskingghFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEA-EDGHYNVLFIGTD 453
Cdd:cd11235  307 RPGTC--------VDDSSPLPDDTLNFIKSHPLMDEAVTPILNRPLFIKTDVNYRFTKIAVDRVQAkLGQTYDVLFVGTD 378
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 113682328 454 NSVVLKMITIYnkEADTVEEVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQIRVH 514
Cdd:cd11235  379 RGIILKVVSLP--EQGLQASNILEEMPVGPPPEPIQTMQLSRKRRSLYVGSETGVLQVPLA 437
Sema_4 cd11240
The Sema domain, a protein interacting module, of class 4 semaphorins (Sema4); Class 4 ...
50-511 4.07e-133

The Sema domain, a protein interacting module, of class 4 semaphorins (Sema4); Class 4 semaphorins (Sema4s) are transmembrane regulator molecules involved in the development of the nervous system, immune response, cytoskeletal organization, angiogenesis, and cell-cell interactions. There are 7 distinct subfamilies in class 4 semaphorins, named 4A to 4G. Several class 4 subfamilies play important roles in the immune system and are called "immune semaphorins". Sema4A plays critical roles in T cell-DC interactions in the immune response. Sema4D/CD100, expressed by lymphocytes, promotes the aggregation and survival of B lymphocytes and inhibits cytokine-induced migration of immune cells in vitro. It is required for normal activation of B and T lymphocytes. Sema4B negatively regulates basophil functions through T cell-basophil contacts and significantly inhibits IL-4 and IL-6 production from basophils in response to various stimuli, including IL-3 and papain. Sema4s not only influence the activation state of cells but also modulate their migration and survival. The effects of Sema4s on nonlymphoid cells are mediated by plexin D1 and plexin Bs. The Sema4G and Sema4C genes are expressed in the developing cerebellar cortex and are involved in neural tube closure and development of cerebellar granules cells through receptor plexin B2. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200501 [Multi-domain]  Cd Length: 456  Bit Score: 405.26  E-value: 4.07e-133
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  50 EGRLQQY-TMLLDETQERLIIGGKDVLYSLNLERITAP-HKRIVWSSSQEQVEDCLMQGRE-KPECANYIKLVQHYNSTH 126
Cdd:cd11240    3 QEGIQNYsTLLLSEDEGTLYVGAREALFALNVSDISTElKDKIKWEASEDKKKECANKGKDnQTDCFNFIRILQFYNSTH 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 127 LLACGTGAFSPVCAYIRVSRgaeqereFRLESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGN 205
Cdd:cd11240   83 LYVCGTFAFSPRCTYINLSD-------FSLSSIKFEDGKGRCPFDPAQRYTAIMVDGELYSATVNNFLGSEPVISRnHSE 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 206 HSFIRTEVGDRQqLNEPKFVGSAVIP---DNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWS 282
Cdd:cd11240  156 GNVLKTENTLRW-LNEPAFVGSAHIResiDSPDGDDDKIYFFFTETAVEYDFYEKVTVSRVARVCKGDLGGQRTLQKKWT 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 283 SFLKTRLICSVagPNGiDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDH 362
Cdd:cd11240  235 TFLKAQLVCSQ--PDS-GLPFNVLRDVFVLSPDSWDATIFYGVFTSQWNVSGLSAVCAYSLEDIKKVFSGKYKEFNRETS 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 363 HWKVYDGKVPYPRPGSCaskINGGH----FSSSKEYSDEVLRFARSHPLMFQAVQPVHrRPILLDTegGRKLTQLAVDRV 438
Cdd:cd11240  312 KWSRYTGPVPDPRPGAC---ITNSArsqgITSSLNLPDNVLTFVKDHPLMDEQVHPIN-RPLLVKS--GVNYTRIAVHRV 385
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 113682328 439 EAEDGH-YNVLFIGTDNSVVLKMITIyNKEAdtveeVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQI 511
Cdd:cd11240  386 QALDGQtYTVLFLGTEDGFLHKAVSL-DGGM-----HIIEEIQLFDQPQPVKNLLLSSSKGVLYVGSSSGVVQV 453
Sema smart00630
semaphorin domain;
57-488 2.93e-131

semaphorin domain;


Pssm-ID: 214747  Cd Length: 390  Bit Score: 398.28  E-value: 2.93e-131
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328    57 TMLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGREKP-ECANYIKLVQHYNSTHLLACGTGAF 135
Cdd:smart00630   3 HLLLDEDNGTLYVGARNRLYQLSLNLILEAELKTGPVLSSPDCEECVSKGKDPPtDCVNYIRLLLDYNEDRLLVCGTNAF 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328   136 SPVCAYIRVsrgaeqerefrlesdhiesgrgrvpfhpnsplastvyrGELFVGLYTDYWENDAALYRLG--------NHS 207
Cdd:smart00630  83 QPVCRLRNL--------------------------------------GELYVGTVADFSGSDPAIPRSLsvrrlkgtSGV 124
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328   208 FIRTEVGDRQQLNEPKFVGSAVIpdnddpaDDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSFLKT 287
Cdd:smart00630 125 SLRTVLYDSKWLNEPNFVYAFES-------GDFVYFFFRETAVEDDNCGKAVHSRVARVCKNDVGGPRSLDKKWTSFLKA 197
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328   288 RLICSVAGPngIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWKVY 367
Cdd:smart00630 198 RLECSVPGE--DPFYFNELQAAFLLPPGSESDDVLYGVFSTSSNPIPGSAVCAFSLSDINAVFNGPFKECETSTSQWLPY 275
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328   368 -DGKVPYPRPGSCASKIngghfSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVeAEDGHYN 446
Cdd:smart00630 276 sRGKVPYPRPGTCPNKP-----PSSKDLPDETLNFIKSHPLMDEVVQPLTGRPLFVKTDSNYLLTSIAVDRV-ATDGNYT 349
                          410       420       430       440
                   ....*....|....*....|....*....|....*....|..
gi 113682328   447 VLFIGTDNSVVLKMITIYNkeADTVEEVLLEELQVFKVPVPI 488
Cdd:smart00630 350 VLFLGTSDGRILKVVLSES--SSSSESVVLEEISVFPDGSPI 389
Sema_1A cd11237
The Sema domain, a protein interacting module, of semaphorin 1A (Sema1A); Sema1A is a ...
59-516 9.21e-111

The Sema domain, a protein interacting module, of semaphorin 1A (Sema1A); Sema1A is a transmembrane protein. It has been shown to mediate the defasciculation of motor axon bundles at specific choice points. Sema1A binds to its receptor plexin A (PlexA), which in turn triggers downstream signaling events involving the receptor tyrosine kinase Otk, the evolutionarily conserved flavoprotein monooxygenase molecule interacting with CasL (MICAL), and the A kinase anchoring protein Nervy, leading to repulsive growth-cone response. Sema1A has also been shown to be involved in synaptic formation. It is a member of the semaphorin family of proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200498  Cd Length: 446  Bit Score: 347.01  E-value: 9.21e-111
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  59 LLDETQERLIIGGKDVLYSLNLERITAPHkRIVWSSSQEQVEDCLMQGREKPECANYIKLVQHYNSTHLLACGTGAFSPV 138
Cdd:cd11237    9 LLDQDGNSLLVGARNAVYNISLSDLTENQ-RIEWPSSDAHREMCLLKGKSEDDCQNYIRVLAKKSAGRLLVCGTNAYKPL 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 139 C-AYIRVSRGAEQEREFrlesdhieSGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYRlgnhSFIRTEVGDRQ 217
Cdd:cd11237   88 CrEYTVKDGGYRVEREF--------DGQGLCPYDPKHNSTAVYADGQLYSATVADFSGADPLIYR----EPLRTERYDLK 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 218 QLNEPKFVGSavIPDNDdpaddKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSFLKTRLICSVagPN 297
Cdd:cd11237  156 QLNAPNFVSS--FAYGD-----YVYFFFRETAVEYINCGKAIYSRVARVCKNDKGGPHPFRDRWTSFLKARLNCSV--PG 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 298 GIDTHFDELE---DVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHW-KVYDGKVPY 373
Cdd:cd11237  227 EYPFYFNEIQstsDIVEGGYGGKSAKLIYGVFTTPVNSISGSAVCAFSLQDILEVFDGSFKEQQDINSNWlPVPSNKVPE 306
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 374 PRPGSCAskingghfSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVD-RVEAEDGH-YNVLFIG 451
Cdd:cd11237  307 PRPGQCV--------NDSRTLPDVTVNFIKSHPLMDEAVPSFFGRPILVRTSLQYRFTQIAVDpQVKALDGKyYDVLFIG 378
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 113682328 452 TDNSVVLKMITIYNKEA-DTVEEVLLEELQVFKVPVPITEILISTKRQQ--LYVGSELGVTQIRVHQC 516
Cdd:cd11237  379 TDDGKVLKAVNIASADTvDKVSPVVIEETQVFPRGVPIRNLLIVRGKDDgrLVVVSDDEIVSIPLHRC 446
Sema_4G cd11262
The Sema domain, a protein interacting module, of semaphorin 4G (Sema4G); The Sema4G and ...
51-511 3.00e-110

The Sema domain, a protein interacting module, of semaphorin 4G (Sema4G); The Sema4G and Sema4C genes are expressed in the developing cerebellar cortex. Sema4G and Sema4C proteins specifically bind to Plexin B2 expressed in the cerebellar granule cells. Sema4G and Sema4C are involved in neural tube closure and cerebellar granule cell development through Plexin B2.Sema4G belongs to the class 4 transmembrane semaphorin family of proteins. Semaphorins are regulatory molecules involved in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200523  Cd Length: 457  Bit Score: 345.98  E-value: 3.00e-110
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  51 GRLQQY-TMLLDETQERLIIGGKDVLYSLNLERITAP-HKRIVWSSSQEQVEDCLMQGRE-KPECANYIKLVQHYNSTHL 127
Cdd:cd11262    5 GPAQNYsTLLLEDESGRLYVGARGAIFSLNASDISDSsALTIDWEASPEQKHQCLKKGKNnQTECFNHVRFLQRFNSTHL 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 128 LACGTGAFSPVCAYIRvsrgaeqEREFRLeSDHIESGRGRVPFHPNSPLASTVYRGELFVGlyTDY-WENDAALYRLGNH 206
Cdd:cd11262   85 YTCGTHAFRPLCAYID-------AERFTL-SSQFEEGKEKCPYDPAKGYTGLIVDGQLYTA--SQYeFRSFPDIRRNSPQ 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 207 SFIRTEVGDRQQLNEPKFVGSAVIPDNDDPA---DDKVYYFFTERVadVEGGNKAVYT---RVARVCANDQGGQRMLVNR 280
Cdd:cd11262  155 PTLRTEEAPTRWLNDADFVGSVLVRESMNSSvgdDDKIYFFFTERS--QEETAYFSQSrvaRVARVCKGDRGGKKTLQRK 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 281 WSSFLKTRLICSVagPNgIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERT 360
Cdd:cd11262  233 WTSFLKARLVCYI--PE-YEFLFNVLRSVFVLWGSTPQDTVFYGIFGLEWKNVKASAICRYSLSDIQTAFEGPYMEYQDS 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 361 DHHWKVYDGKVPYPRPGSCaskINGGH----FSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLdtEGGRKLTQLAVD 436
Cdd:cd11262  310 SSKWSRYTGKVPEPRPGSC---ITDEHrsqgINSSQDLPDNVLDFVRRHPLMAEQVLPVEGRPLLF--KRNVIYTKIAVQ 384
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 113682328 437 RVEAEDGH-YNVLFIGTDNSVVLKMITIYNKEAdtveevLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQI 511
Cdd:cd11262  385 TVRGLDGRvYDVLFLGTDEGWLHKAVVIGSAVH------IIEELQVFREPQPVENLVISKKQNSLYVGARSGVVQV 454
Sema_4D cd11259
The Sema domain, a protein interacting module, of semaphorin 4D (Sema4D, also known as CD100); ...
38-510 2.28e-96

The Sema domain, a protein interacting module, of semaphorin 4D (Sema4D, also known as CD100); Sema4D/CD100 is expressed in immune cells and plays critical roles in immune response; it is thus termed an "immune semaphorin". It is expressed by lymphocytes and promotes the aggregation and survival of B lymphocytes and inhibits cytokine-induced migration of immune cells in vitro. Sema4D/CD100 knock-out mice demonstrate that Sema4D is required for normal activation of B and T lymphocytes. Sema4D increases B-cell and DC function using either Plexin B1 or CD72 as receptors. The function of Sema4D in immune response implicates its role in infectious and noninfectious diseases. Sema4D belongs to the class 4 transmembrane semaphorin family of proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200520  Cd Length: 471  Bit Score: 309.86  E-value: 2.28e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  38 WELNRTWVFQAGEGRLQQY-TMLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGR-EKPECANY 115
Cdd:cd11259    2 WEHKEVQLVHFHEPDVSNYsTLLLSEDKDVLYVGAREAVFALNALNISEKQHELYWKVSEDKRTKCAVKGKsKQTECRNY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 116 IKLVQHYNSTHLLACGTGAFSPVCAYIRVSrgaeqerEFRLESDHiESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWE 195
Cdd:cd11259   82 IRVLQPLNDTFLYVCGTNAFQPTCDYLNLT-------SFRLLGKN-EDGKGRCPFDPAQSYTSVMVDGELYSGTSYNFLG 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 196 NDAALYRLGNHSFIRTEVGdRQQLNEPKFVGSAVI---PDNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQG 272
Cdd:cd11259  154 SEPIISRNSSQSPLRTEYA-IPWLNEPSFVFADVIradPDSPDGEDDKIYFFFTEVSVEYEFVGKLLIPRIARVCKGDQG 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 273 GQRMLVNRWSSFLKTRLICSVAGPNGIdthFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFN- 351
Cdd:cd11259  233 GLRTLQKKWTSFLKARLICSIPDKNLV---FNVVNDVFILKSPTLKEPVIYGVFTPQLNNVGLSAVCAYNLSTVEEVFSk 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 352 GPFAHR---ERTDHHWKVYDGKVPYPRPGSCASKIN-GGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEgg 427
Cdd:cd11259  310 GKYMQSatvEQSHTKWVRYNGEVPKPRPGACINNEArAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIGNRPRLIKKD-- 387
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 428 RKLTQLAVDRVEAEDGH-YNVLFIGTDNSVVLKMITiYNKEADTVEEVlleelQVFKVPVPITEILISTK--RQQLYVGS 504
Cdd:cd11259  388 VNYTQIVVDRVQALDGTiYDVMFISTDRGALHKAIS-LENEVHIIEET-----QLFPDFEPVQTLLLSSKkgRRFLYAGS 461

                 ....*.
gi 113682328 505 ELGVTQ 510
Cdd:cd11259  462 NSGVVQ 467
Sema_6 cd11242
The Sema domain, a protein interacting module, of class 6 semaphorins (Sema6); Class 6 ...
48-482 1.56e-91

The Sema domain, a protein interacting module, of class 6 semaphorins (Sema6); Class 6 semaphorins (Sema6s) are membrane associated semaphorins. There are 6 subfamilies named 6A to 6D. Sema6s bind to plexin As in a neuropilin independent fashion. Sema6-plexin A signaling plays important roles in lamina-specific axon projections. Interactions between plexin A2, plexin A4, and Sema6A control lamina-restricted projection of hippocampal mossy fibers. Interactions between Sema6C, Sema6D and plexin A1 shape the stereotypic trajectories of sensory axons in the spinal cord. In addition to axon targeting, Sema6D-plexin A1 interactions influence a wide range of other biological processes. During cardiac development, Sema6D attracts or repels endothelial cells in the cardiac tube depending on the expression patterns of specific coreceptors in addition to plexin A1. Furthermore, Sema6D binds a receptor complex comprising of plexin A1, Trem2 (triggering receptor expressed on myeloid cells 2), and DAP12 on dendritic cells and osteoclasts to mediate T-cell-DC interactions and to control bone development, respectively. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200503 [Multi-domain]  Cd Length: 465  Bit Score: 296.73  E-value: 1.56e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  48 AGEGRLQ-QYTMLLDETqerLIIGGKDVLYSLNLERITA----PHKRIVWSSSQEQVEDCLMQGREKPECANYIKLVQHY 122
Cdd:cd11242    4 TARHRLDfQRMLRINRT---LYIAARDHVYTVDLDASHTeeivPSKKLTWRSRQADVENCRMKGKHKDECHNFIKVLVPR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 123 NSTHLLACGTGAFSPVCAYIRVSRgaeqerefrLESDHIE-SGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALY 201
Cdd:cd11242   81 NDETLFVCGTNAFNPVCRNYRIDT---------LEQDGEEiSGMARCPFDAKQANVALFADGKLYSATVTDFLASDAVIY 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 202 R-LGNHSFIRTEVGDRQQLNEPKFVgSAVipdnddPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGG-QRMLVN 279
Cdd:cd11242  152 RsLGDSPTLRTVKYDSKWLKEPHFV-HAV------EYGDYVYFFFREIAVEYNTLGKVVFSRVARVCKNDMGGsPRVLEK 224
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 280 RWSSFLKTRLICSVAGpngiDTHF-----DELEDVFVLRKKdeknPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPF 354
Cdd:cd11242  225 QWTSFLKARLNCSVPG----DSHFyfdvlQAVTDVIRINGR----PVVLGVFTTQYNSIPGSAVCAFDMDDIEKVFEGRF 296
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 355 AHRERTDHHWK-VYDGKVPYPRPGSCASKINGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQL 433
Cdd:cd11242  297 KEQKSPDSAWTpVPEDRVPKPRPGCCAGSGSAEKYKTSNDFPDDTLNFIKTHPLMDEAVPSIINRPWFTRTMVRYRLTQI 376
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*....
gi 113682328 434 AVDRVEAEDGHYNVLFIGTDNSVVLKMITIYNKEADTvEEVLLEELQVF 482
Cdd:cd11242  377 AVDNAAGPYQNYTVVFLGSEAGTVLKFLARIGPSGSN-GSVFLEEIDVY 424
Sema_4B cd11257
The Sema domain, a protein interacting module, of semaphorin 4B (Sema4B); Sema4B, expressed in ...
57-513 1.85e-91

The Sema domain, a protein interacting module, of semaphorin 4B (Sema4B); Sema4B, expressed in T and B cells, is an immune semaphorin. It functions as a negative regulatory of basophils through T cell-basophil contacts and it significantly inhibits IL-4 and IL-6 production from basophils in response to various stimuli, including IL-3 and papain. In addition, T cell-derived Sema4B suppresses basophil-mediated Th2 skewing and humoral memory responses. Sema4B may be also involved in lung cancer cell mobility by inducing the degradation of CLCP1 (CUB, LCCL-homology, coagulation factor V/VIII homology domains protein). Sema4B is characterized by a PDZ-binding motif at the carboxy-terminus, which mediates interaction with the post-synaptic density protein PSD-95/SAP90, which is thought to play a central role during synaptogenesis and in the structure and function of post-synaptic specializations of excitatory synapses. Sema4B belongs to class 4 transmembrane semaphorin family proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200518  Cd Length: 464  Bit Score: 296.77  E-value: 1.85e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  57 TMLLDETQERLIIGGKDVLYSLNLERI--TAPHKRIVWSSSQEQVEDCLMQGRE-KPECANYIKLVQHYNSTHLLACGTG 133
Cdd:cd11257   12 ALLLSKDGNMLYVGARETLFALSSNDIspTGEQQELTWSADEEKKQECSFKGKDpQRDCQNYIKILLRLNSTHLFTCGTY 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 134 AFSPVCAYIRVSrgaeqerEFRLESDH-----IESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGNHS 207
Cdd:cd11257   92 AFSPICTYIVMT-------NFSLERDEkgeplLEDGKGRCPFDPEYKSTAIMVDGELYTGTVSNFQGNDPIIYRsLGSGT 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 208 FIRTEvGDRQQLNEPKFVGSAVIPDNDDPA---DDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSF 284
Cdd:cd11257  165 PLKTE-NSLNWLQDPAFVGSAYIQESLPKLvgdDDKIYFFFSETGKEFDFFENTIVSRIARVCKGDEGGERVLQKRWTTF 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 285 LKTRLICSVAGpNGIDthFDELEDVFVL--RKKDEKNPEIFGLFstTSAVFKG----YAVCMYNMDDIRAAFNGPFAHRE 358
Cdd:cd11257  244 LKAQLLCSLPD-DGFP--FNVLQDVFVLtpSPEDWKDTLFYGVF--TSQWHKGtagsSAVCVFTMDQVQRAFNGLYKEVN 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 359 RTDHHWKVYDGKVPYPRPGSC---ASKINGghFSSSKEYSDEVLRFARSHPLMfqaVQPVHRRPILLDTEGgrKLTQLAV 435
Cdd:cd11257  319 RETQQWYTYTHPVPEPRPGACitnSARERK--INSSLHMPDRVLNFVKDHFLM---DGQVRSQPLLLQPQV--RYTQIAV 391
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 113682328 436 DRVEAEDGHYNVLFIGTDNSVVLKMITIYNKEAdtveevLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQIRV 513
Cdd:cd11257  392 HRVKGLHKTYDVLFLGTDDGRLHKAVSVGPMVH------IIEELQIFSEGQPVQNLLLDTHKGLLYASSHSGVVQVPV 463
Sema_4E cd11260
The Sema domain, a protein interacting module, of semaphorin 4E (Sema4E); Sema4E is expressed ...
57-513 2.00e-91

The Sema domain, a protein interacting module, of semaphorin 4E (Sema4E); Sema4E is expressed in the epithelial cells that line the pharyngeal arches in zebrafish. It may act as a guidance molecule to restrict the branchiomotor axons to the mesenchymal cells. Gain-of-function and loss-of-function studies demonstrate that Sema4E is essential for the guidance of facial axons from the hindbrain into their pharyngeal arch targets and is sufficient for guidance of gill motor axons. Sema4E guides facial motor axons by a repulsive action. Sema4E belongs to the class 4 transmembrane semaphorin family of proteins. Semaphorins are regulatory molecules involved in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200521 [Multi-domain]  Cd Length: 456  Bit Score: 296.43  E-value: 2.00e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  57 TMLLDETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGRE-KPECANYIKLVQHYNSTHLLACGTGAF 135
Cdd:cd11260   11 TMLLREDLGLLVLGAREAVFALDLNDISVKRAKVLWEVTEEKQKDCTNKGKHaDIDCHNYIRILHKMNDSRMYVCGTNAF 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 136 SPVCAYIRVSRGAEQerefrLESDHiESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYRLGNHSfIRTEVgD 215
Cdd:cd11260   91 SPTCDYISYDDGQLT-----LEGKQ-EDGKGKCPFDPFQRYSSVMVDQDLYSATSMNFLGSEPVIMRSSPIT-IRTEF-K 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 216 RQQLNEPKFVGSAVIP---DNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSFLKTRLICS 292
Cdd:cd11260  163 SSWLNEPNFIYMAAVPeseDSPEGDDDKIYLFFSETAVEYDFYNKLVVSRVARVCKGDLGGQRTLQKKWTSFLKARLDCS 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 293 VAGPNGIDThfdeLEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDI-----RAAFNGPFAhRERTDHHWKVY 367
Cdd:cd11260  243 VPEPSLPYV----IQDVFHVCHQDWRKCVFYAVFTSQSDSSQSSAVCAYNVTDIsnvfsRGKFKTPVA-VETSFVKWVMY 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 368 DGKVPYPRPGSC---ASKINGghFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLdtEGGRKLTQLAVDRVEAEDGH 444
Cdd:cd11260  318 SGELPVPRPGACinnAARTSG--IKKSLNLPDKTLQFVKDKPLMDQAVHPITGKPLLV--KRGALFTRIVVDMVTAADGQ 393
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 445 -YNVLFIGTDNSVVLKMITiYNKEAdtveeVLLEELQVFKVPVPITEILISTKrqQLYVGSELGVTQIRV 513
Cdd:cd11260  394 sYPVMFIGTANGYVLKAVN-YDGEM-----HIIEEVQLFEPEEPIDILRLSQN--QLYAGSASGVVQMPV 455
Sema_4C cd11258
The Sema domain, a protein interacting module, of semaphorin 4C (Sema4C); Sema4C acts as a ...
53-511 1.37e-87

The Sema domain, a protein interacting module, of semaphorin 4C (Sema4C); Sema4C acts as a Plexin B2 ligand to regulate the development of cerebellar granule cells and to modulate ureteric branching in the developing kidney. The binding of Sema4C to Plexin B2 results the phosphorylation of downstream regulator ErbB-2 and the plexin protein itself. The cytoplasmic region of Sema4C binds a neurite-outgrowth-related protein SFAP75, suggesting that Sema4C may also play a role in neural function. Sema4C belongs to the class 4 transmembrane semaphorin family of proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200519 [Multi-domain]  Cd Length: 458  Bit Score: 286.31  E-value: 1.37e-87
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  53 LQQYTML-LDETQERLIIGGKDVLYSLNLERITApHKRIVWSSSQEQVEDCLMQGRE-KPECANYIKLVQHYNSTHLLAC 130
Cdd:cd11258    9 VSNYTTLtLAEHRGLLYVGAREAIFALSLSNIEL-QPPISWEAPAEKKTECAQKGKSnQTECFNYIRFLQPYNQSHLYTC 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 131 GTGAFSPVCAYIRVSrgaeqerEFRLESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGNHSFI 209
Cdd:cd11258   88 GTYAFQPKCAYINML-------TFTLDRAEFEDGKGKCPYDPAKGHTGLIVDGELYSATLNNFLGTEPVILRnLGQHYSM 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 210 RTEVGDrQQLNEPKFVGSAVIPDN---DDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSFLK 286
Cdd:cd11258  161 KTEYLA-FWLNEPHFVGSAFVPESvgsFTGDDDKIYFFFSERAVEYDCDSEQVVARVARVCKGDLGGARTLQKKWTTFLK 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 287 TRLICSVagPNgIDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWKV 366
Cdd:cd11258  240 ARLLCSI--PE-WQLYFNQLKAVFTLEGASWRNTTFFAVFQARWGDMDVSAVCEYQLGEIQQVFEGPYKEYSEQAQKWGR 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 367 YDGKVPYPRPGSCASKINGGH-FSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTegGRKLTQLAVDRVEAEDGH- 444
Cdd:cd11258  317 YTDPVPSPRPGSCINNWHRDHgYTSSLELPDNTLNFVKKHPLMEDRVKPRLGRPLLVPC--NSNFTHVVWTRVLGLDGEt 394
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 113682328 445 YNVLFIGTDNSVVLKMITIYNkeadtvEEVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQI 511
Cdd:cd11258  395 YSVLFIGTLDGWLIKAVSLGS------WVHMIEELQVFDQEPPESLVVSQSSKKLLFAGSRSELLQL 455
Sema_4F cd11261
The Sema domain, a protein interacting module, of semaphorin 4F (Sema4F); Sema4F plays role in ...
54-511 2.81e-85

The Sema domain, a protein interacting module, of semaphorin 4F (Sema4F); Sema4F plays role in heterotypic cell-cell contacts and controls cell proliferation and suppresses tumorigenesis. In neurofibromatosis type 1 (NF1) patients, reduced Sema4F level disrupts Schwann cell/axonal interactions. Experiments using a yeast two-hybrid system show that the extreme C-terminus of Sema4F interacts with the PDZ domains of post-synaptic density protein SAP90/PSD-95, indicating possible functional involvement of Semas4F at glutamatergic synapses. Recent work also suggests a role for Sema4F in the injury response of intramedullary axotomized motoneuron. Sema4F belongs to the class 4 transmembrane semaphorin family of proteins. Semaphorins are regulator molecules involved in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200522 [Multi-domain]  Cd Length: 460  Bit Score: 279.85  E-value: 2.81e-85
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  54 QQYTMLL-DETQERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDCLMQGREKPECANYIKLVQHYNSTHLLACGT 132
Cdd:cd11261   12 YNYSVLLvDPASHTLYVGARDAIFALTLPFSGERPRRIDWMVPEAHRQNCRKKGKKEAECHNFIRILAIANASHLLTCGT 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 133 GAFSPVCAYIRVSRgaeqereFRlESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGN-HSFIR 210
Cdd:cd11261   92 FAFDPKCGVIDVSS-------FQ-QVERLESGRGKCPFEPAQRSAAIMAGGVLYAATVKNFLGTEPIISRaVGRaEEWIR 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 211 TEVgDRQQLNEPKFVGSAVI---PDNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSFLKT 287
Cdd:cd11261  164 TET-LPSWLNAPAFVAAVFLspaEWGDEDGDDEIYFFFTETAREYDSYERIKVPRVARVCAGDLGGRKTLQQRWTTFLKA 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 288 RLICSvaGPNGiDTHFDELEDVFVLRKKDEKNPEIF-GLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHW-K 365
Cdd:cd11261  243 DLLCP--GPEH-GRASSILQDVTTLRPLPGAGTPIFyGIFSSQWEGASISAVCAFRPQDIRRVMNGPFREFKHDCNRGlP 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 366 VYDGKVPYPRPGSC-ASKINGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTegGRKLTQLAVDRVEAEDG- 443
Cdd:cd11261  320 VMDSDVPQPRPGECiTNNMKLLGFGSSLSLPDRVLTFVRDHPLMDRPVFPADGHPLLVTT--DTAYLRVAAHRVTSLSGk 397
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 113682328 444 HYNVLFIGTDNSVVLKMITIYNKEAdtveevLLEELQVFKVPVPITEILIstKRQQLYVGSELGVTQI 511
Cdd:cd11261  398 EYDVLYLGTEDGHLHRAVRIGAQLS------VLEDLALFPEPQPVENLQL--HHNWLLVGSDTEVTQI 457
Sema_6D cd11269
The Sema domain, a protein interacting module, of semaphorin 6D (Sema6D); Sema6D is expressed ...
59-482 1.68e-82

The Sema domain, a protein interacting module, of semaphorin 6D (Sema6D); Sema6D is expressed predominantly in the nervous system during embryogenesis and it uses Plexin-A1 as a receptor. It displays repellent activity for dorsal root ganglion axons. Sema6D also acts as a regulator of late phase primary immune responses. In addition, Sema6D is overexpressed in gastric carcinoma, indicating that it may have an important role in the occurrence and development of the cancer. Sema6D is a member of the class 6 semaphorin family of proteins, which are membrane associated semaphorins. Semaphorins are regulatory molecules involved in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200530 [Multi-domain]  Cd Length: 465  Bit Score: 272.67  E-value: 1.68e-82
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  59 LLDETQERLIIGGKDVLYSLNLERI----TAPHKRIVWSSSQEQVEDCLMQGREKPECANYIKLVQHYNSTHLLACGTGA 134
Cdd:cd11269   13 LMLKIRDTLYIAGRDQVYTVNLNEVpkteVTPSRKLTWRSRQQDRENCAMKGKHKDECHNFIKVFVPRNDEMVFVCGTNA 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 135 FSPVCAYIRVSRgaeqerefrLESDHIE-SGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGNHSFIRTE 212
Cdd:cd11269   93 FNPMCRYYRLST---------LEYDGEEiSGLARCPFDARQTNVALFADGKLYSATVADFLASDAVIYRsMGDGSALRTI 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 213 VGDRQQLNEPKFVGSAvipdnddPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGG-QRMLVNRWSSFLKTRLIC 291
Cdd:cd11269  164 KYDSKWIKEPHFLHAI-------EYGNYVYFFFREIAVEHNNLGKAVYSRVARICKNDMGGsQRVLEKHWTSFLKARLNC 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 292 SVAGPNGIdtHFDELEDVFVLRkkdEKN--PEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWK-VYD 368
Cdd:cd11269  237 SVPGDSFF--YFDVLQSITDII---EINgiPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTPDSVWTaVPE 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 369 GKVPYPRPGSCASKINGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEAEDGHYNVL 448
Cdd:cd11269  312 DKVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPSIIEEPWFTKTRVRYRLTAIAVDHAAGPHQNYTVI 391
                        410       420       430
                 ....*....|....*....|....*....|....
gi 113682328 449 FIGTDNSVVLKMITIYNKEADTvEEVLLEELQVF 482
Cdd:cd11269  392 FVGSEAGVVLKILAKTSPFSLN-DSVLLEEIEAY 424
Sema_5 cd11241
The Sema domain, a protein interacting module, of semaphorin 5 (Sema5); Class 5 semaphorins ...
56-511 1.91e-77

The Sema domain, a protein interacting module, of semaphorin 5 (Sema5); Class 5 semaphorins are transmembrane glycoproteins characterized by unique thrombospondin specific repeats in the extracellular region of the protein. There are three subfamilies in class 5 semaphorins, namely 5A, 5B and 5C. Sema5A and Sema5B function as guidance cues for optic and corticofugal nerve development, respectively. Sema5A-induced cell migration requires Met signaling. Sema5C is an early development gene and may play a role in odor-guided behavior. Sema5A is also implicated in cancer. In a screening model for metastasis, the Drosophila Sema5A ortholog, Dsema-5C, has been found to be required in tumorigenicity and metastasis. Sema5A is highly expressed in human pancreatic cancer cells and is associated with tumor growth, invasion and metastasis. Semaphorins are regulatory molecules involved in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200502  Cd Length: 438  Bit Score: 258.25  E-value: 1.91e-77
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  56 YTMLLDETQERLIIGGKDVLYSLNLERITAPhKRIVWSSSQEQVEDCLMQGREKPECANYIKlVQHYNSTHLLACGTGAF 135
Cdd:cd11241   10 SRLVLDPTHDQLIVGARNYLFRLRLQSLSLL-QAVPWNSDEDTKRQCQSKGKSVEECQNYVR-VLLVVGKNLFTCGTYAF 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 136 SPVCAYIRVSRgaeqerefrLESDHIE-SGRGRVPFHPNSP-LASTVYRGELFVGLYTDYWENDAALYR-LGNHSFIRTE 212
Cdd:cd11241   88 SPVCTIRKLSN---------LTQILDTiSGVARCPYSPAHNsTALISASGELYAGTVYDFSGRDPAIYRsLGGKPPLRTA 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 213 VGDRQQLNEPKFVGSAVIpdnddpaDDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSFLKTRLICS 292
Cdd:cd11241  159 QYNSKWLNEPNFVGSYEI-------GNHTYFFFRENAVEHQDCGKTVYSRIARVCKNDIGGRFLLEDTWTTFMKARLNCS 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 293 VAGPngIDTHFDELEDVFVLRKKDeknpEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWKVYdgkvP 372
Cdd:cd11241  232 LPGE--FPFYYNEIQGTFYLPETD----LIYAVFTTNVNGIAGSAICAFNLSAINQAFNGPFKYQENNGSAWLPT----P 301
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 373 YPRPG-SCASKINGGHFSSSKEysdEVLRFARSHPLMFQAVQPVHRRPilLDTEGGRKLTQLAVDRVEAEDG-HYNVLFI 450
Cdd:cd11241  302 NPHPNfQCTTSIDRGQPANTTE---RDLQDAQKYQLMAEVVQPVTKIP--LVTMDDVRFSKLAVDVVQGRGTqLVHIFYV 376
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 113682328 451 GTDNSVVLKMITIYNkeadTVEEVLLEELQVFKVPV--PITEILISTKRQQLYVGSELGVTQI 511
Cdd:cd11241  377 GTDYGTILKMYQPHR----SQKSCTLEEIKILPAMKgePITSLQFLKSEKSLFVGLETGVLRI 435
Sema_6B cd11267
The Sema domain, a protein interacting module, of semaphorin 6B (Sema6B); Sema6B functions as ...
67-483 1.24e-76

The Sema domain, a protein interacting module, of semaphorin 6B (Sema6B); Sema6B functions as repellents for axon growth; this repulsive activity is mediated by its receptor Plexin A4. Sema6B is expressed in CA3, and repels mossy fibers in a Plexin A4 dependent manner. In human, it was shown that peroxisome proliferator-activated receptors (PPARs) and 9-cis-retinoic acid receptor (RXR) regulate human semaphorin 6B (Sema6B) gene expression. Sema6B is a member of the class 6 semaphorin family of proteins, which are membrane associated semaphorins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200528 [Multi-domain]  Cd Length: 466  Bit Score: 257.07  E-value: 1.24e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  67 LIIGGKDVLYSLNLERITAP----HKRIVWSSSQEQVEDCLMQGREKPECANYIKLVQHYNSTHLLACGTGAFSPVCAYI 142
Cdd:cd11267   21 LYIGDRDNLYRVELDPTAGTemryHKKLTWRSNKNDINVCRMKGKHEGECRNFIKVLLLRDYGTLFVCGTNAFNPVCANY 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 143 RVSrgaeqerEFRLESDHIeSGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGNHSFIRTEVGDRQQLNE 221
Cdd:cd11267  101 SID-------TLEPVGDNI-SGMARCPYDPKHANVALFADGMLFTATVTDFLAIDAVIYRsLGDSPALRTVKHDSKWFKE 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 222 PKFVgSAVipdnddPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGG-QRMLVNRWSSFLKTRLICSVAGpngiD 300
Cdd:cd11267  173 PYFV-HAV------EWGSHVYFFFREIAMEFNYLEKVVVSRVARVCKNDMGGsQRVLEKQWTSFLKARLNCSVPG----D 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 301 THF-----DELEDVFVLRKKdeknPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWK-VYDGKVPYP 374
Cdd:cd11267  242 SHFyfnvlQAVSDILNLGGR----PVVLAVFSTPTNSIPGSAVCAFDMTQVAAVFEGRFREQKSPESIWTpVPEELVPRP 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 375 RPGSCAskINGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEAEDGHYNVLFIGTDN 454
Cdd:cd11267  318 RPGCCA--APGMRYNSSSTLPDEVLNFVKTHPLMDEAVPSLGHAPWIVRTMTRYQLTHMVVDTEAGPHGNHTVVFLGSTR 395
                        410       420       430
                 ....*....|....*....|....*....|.
gi 113682328 455 SVVLKMITIYNKEADTV--EEVLLEELQVFK 483
Cdd:cd11267  396 GTVLKFLIIPNASSSEIsnQSVFLEELETYN 426
Sema_6A cd11266
The Sema domain, a protein interacting module, of semaphorins 6A (Sema6A); In the cerebellum, ...
55-482 8.30e-75

The Sema domain, a protein interacting module, of semaphorins 6A (Sema6A); In the cerebellum, Sema6A-plexin A2 signaling modulates granule cell migration by controlling centrosome positioning. Besides plexin A2, plexin A4 is also found to be a receptor of Sema6A. Interactions between plexin A2, plexin A4, and Sema6A control lamina-restricted projection of hippocampal mossy fibers. It is required for the clustering of boundary cap cells at the PNS/CNS interface and thus, prevents motoneurons from streaming out of the ventral spinal cord. At the dorsal root entry site, it organizes the segregation of dorsal roots. Sema6A may also be involved in axonal pathfinding processes in the periinfarct and homotopic contralateral cortex. Sema6A is a member of the class 6 semaphorin family of proteins, which are membrane associated semaphorins. Semaphorins are regulatory molecules involved in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200527 [Multi-domain]  Cd Length: 466  Bit Score: 251.87  E-value: 8.30e-75
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  55 QYTMLLDETqerLIIGGKDVLYSLNLERITAPH----KRIVWSSSQEQVEDCLMQGREKPECANYIKLVQHYNSTHLLAC 130
Cdd:cd11266   12 QMIMIMNRT---LYIAARDHIYTVDIDTSHTEEiyfsKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKRNDDTLFVC 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 131 GTGAFSPVCAYIRVSRGAEQEREFrlesdhieSGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGNHSFI 209
Cdd:cd11266   89 GTNAFNPSCRNYKMDTLEFFGDEF--------SGMARCPYDAKHANVALFADGKLYSATVTDFLAIDAVIYRsLGDSPTL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 210 RTEVGDRQQLNEPKFVGSAvipdnddPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGG-QRMLVNRWSSFLKTR 288
Cdd:cd11266  161 RTVKHDSKWLKEPYFVQAV-------DYGDYIYFFFREIAVEYNSMGKVVFPRVAQVCKNDMGGsQRVLEKQWTSFLKAR 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 289 LICSVAGpngiDTHF-----DELEDVFVLRKKDEknpeIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHH 363
Cdd:cd11266  234 LNCSVPG----DSHFyfnilQAVTDVIHINGRDV----VLATFSTPYNSIPGSAVCAYDMLDIASVFTGRFKEQKSPDST 305
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 364 WK-VYDGKVPYPRPGSCASKINGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEAED 442
Cdd:cd11266  306 WTpVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPY 385
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|
gi 113682328 443 GHYNVLFIGTDNSVVLKMITIYNKEADTVEEVLLEELQVF 482
Cdd:cd11266  386 QNHTVVFLGSEKGIILKFLARTGNSGFLNDSLFLEEMNVY 425
Sema_5C cd11265
The Sema domain, a protein interacting module, of semaphorin 5C (sema5C); In Drosophila, ...
58-511 8.92e-75

The Sema domain, a protein interacting module, of semaphorin 5C (sema5C); In Drosophila, Sema5C was identified as an early development gene, which is expressed in stage 2 embryos with a striped pattern emerging at later stages. Sema5c may play a role in odor-guided behavior and in tumorigenesis. Sema5C belongs to class 5 semaphorin family of proteins, which are transmembrane glycoproteins characterized by unique thrombospondin specific repeats in the extracellular region of the protein. Semaphorins are regulatory molecules involved in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200526  Cd Length: 433  Bit Score: 250.85  E-value: 8.92e-75
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  58 MLLDETQERLIIGGKDVLYSLNLERITaPHKRIVWSSSQEQVEDCLMQGREKPECANYIKlVQHYNSTHLLACGTGAFSP 137
Cdd:cd11265   12 MLFDVARNQVIVGARDNLYRLSLDGLE-LLERASWPAAESKVALCQNKGQSEEDCHNYVK-VLLSYGKQLFACGTNAFSP 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 138 VCAYirvsrgaeqeREFRLESDHIE--SGRGRVPFHPNSPLASTVY-RGELFVGLYTDYWENDAALYRLG---NHSFIRT 211
Cdd:cd11265   90 RCSW----------REMENLTSVTEwdSGVAKCPYSPHANITALLSsSGQLFVGSPTDFSGSDSAIYRTLgtsNKSFLRT 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 212 EVGDRQQLNEPKFVGSAvipdnddPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLV-NRWSSFLKTRLI 290
Cdd:cd11265  160 KQYNSKWLNEPQFVGSF-------ETGNFVYFLFRESAVEYMNCGKVIYSRIARVCKNDVGGGTMLLkDNWTTFLKARLN 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 291 CSVagPNGIDTHFDELEDVFVLrkKDEKnpEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWKVYDgk 370
Cdd:cd11265  233 CSL--PGEYPFYFDEIQGMTYL--PDEG--ILYATFTTPENSIAGSAVCAFNLSSINAAFDGPFKHQESSGAAWERVN-- 304
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 371 VPYPRPGSCASKINGGHFSSSKEYSdevlrfarshpLMFQAVQPVHRRPilLDTEGGRKLTQLAVDRVEAE-DGHYNVLF 449
Cdd:cd11265  305 VNHRDHFNQCSSSSSSHLLESSRYQ-----------LMDEAVQPITLEP--LHHAKLERFSHIAVDVIPTKiHQSVHVLY 371
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 113682328 450 IGTDNSVVLKMITIYnkeaDTVEEVLLEELQVFKVPV-PITEILISTKRQQLYVGSELGVTQI 511
Cdd:cd11265  372 VATTGGLIKKISVLP----RTQETCLVEIWQPLPTPDsPIKTMQYLKVTDSLYVGTELALMRI 430
Sema_6E cd11270
The Sema domain, a protein interacting module, semaphorin 6E (sema6E); Sema6E is expressed ...
55-482 1.62e-73

The Sema domain, a protein interacting module, semaphorin 6E (sema6E); Sema6E is expressed predominantly in the nervous system during embryogenesis. It binds Plexin A1 and might utilize it as a receptor to repel axons of specific types during development. Sema6E acts as a repellent to dorsal root ganglion axons as well as sympathetic axons. Sema6E is a member of the class 6 semaphorin family of proteins, which are membrane associated semaphorins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200531 [Multi-domain]  Cd Length: 462  Bit Score: 248.48  E-value: 1.62e-73
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  55 QYTMLLDETqerLIIGGKDVLYSLNLERITA---PHKRIVWSSsqEQVEDCLMQGREKPECANYIKLVQHYNSTHLLACG 131
Cdd:cd11270   12 QRMLRINHM---VYIAARDHVFAINLSASLErivPQQKLTWKT--KDVEKCTVRGKNSDECYNYIKVLVPRNDETLFACG 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 132 TGAFSPVCAYIRVSRGAEQEREFrlesdhieSGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGNHS-FI 209
Cdd:cd11270   87 TNAFNPTCRNYKMSSLEQDGEEV--------IGQARCPFESRQSNVGLFAGGDFYSATMTDFLASDAVIYRsLGESSpVL 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 210 RTEVGDRQQLNEPKFVGSAvipdnddPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQ-RMLVNRWSSFLKTR 288
Cdd:cd11270  159 RTVKYDSKWLREPHFLHAI-------EYGNYVYFFLSEIAVEYTTLGKVVFSRVARVCKNDNGGSpRVLERYWTSFLKAR 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 289 LICSVAGPNGIdtHFDELEDVFVLRKKDEKnPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWK-VY 367
Cdd:cd11270  232 LNCSVPGDSFF--YFDVLQSLTNVMQINHR-PAVLGVFTTQANSITGSAVCAFYMDDIEKVFNGKFKEQRNSESAWTpVP 308
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 368 DGKVPYPRPGSCASKINGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRKLTQLAVDRVEAEDGHYNV 447
Cdd:cd11270  309 DEAVPKPRPGSCAGDGPAAGYKSSTNFPDETLTFIKSYPLMDEAVPSVNNRPCFTRTTSRFKLTQIAVDTAAGPYKNYTV 388
                        410       420       430
                 ....*....|....*....|....*....|....*
gi 113682328 448 LFIGTDNSVVLKMITiYNKEADTVEEVLLEELQVF 482
Cdd:cd11270  389 VFLGSENGHVLKVLA-SMHPNSSYSTQVLEDIDVY 422
Sema_4A cd11256
The Sema domain, a protein interacting module, of semaphorin 4A (Sema4A); Sema4A is expressed ...
53-508 1.19e-71

The Sema domain, a protein interacting module, of semaphorin 4A (Sema4A); Sema4A is expressed in immune cells and is thus termed an "immune semaphorin". It plays critical roles in T cell-DC interactions in the immune response. It has been reported to enhance activation and differentiation of T cells in vitro and generation of antigen-specific T cells in vivo. The function of Sema4A in the immune response implicates its role in infectious and noninfectious diseases. Sema4A exerts its function through three receptors, namely Plexin B, Plexin D1, and Tim-2. Sema4A belongs to the class 4 transmembrane semaphorin family of proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. TThe Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200517 [Multi-domain]  Cd Length: 447  Bit Score: 242.89  E-value: 1.19e-71
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  53 LQQY-TMLLDETQERLIIGGKDVLYSLNLERITAPHKR--IVWSSSQEQVEDCLMQGR-EKPECANYIKLVQHYNSTHLL 128
Cdd:cd11256    7 VHNYdQLLLSPDETTLYVGARDNILALGIRTPGPIRLKhqIPWPANDSKISECAFKKKsNETECFNFIRVLVPVNGTHLY 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 129 ACGTGAFSPVCAYIRVsrgaeqeREFRL----ESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-L 203
Cdd:cd11256   87 TCGTYAFSPACTYIEL-------DHFSLpppnGTIITMDGKGQSPFDPQHNYTAILVDGELYTGTMNNFRGNEPIIFRnL 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 204 GNHSFIRTEVGDRQQLNEPKFVGSAVIPDnddpaDDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSS 283
Cdd:cd11256  160 GTKVSLKTDGFLRWLNADAVFVASFNPQG-----DSKVYFFFEETAREFDFFEKLTVARVARVCKNDVGGEKLLQKKWTT 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 284 FLKTRLICSVAGpngiDTHFDELEDVFVLRKKDEKNPEIFGLFSTTSAV--FKGYAVCMYNMDDIRAAFNGPFAHRERTD 361
Cdd:cd11256  235 FLKAQLTCSQQG----HFPFNVIHHVALLNQPDPNNSVFYAVFTSQWQLggRRSSAVCAYKLNDIEKVFNGKYKELNKES 310
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 362 HHWKVYDGKVPYPRPGSCAskinGGHFssskeySDEVLRFARSHPLMFQAVQPVHRRPILLDTegGRKLTQLAVDRVEAE 441
Cdd:cd11256  311 SRWTRYMGPVSDPRPGSCS----GGKS------SDKALNFMKDHFLMDEVVLPGAGRPLLVKS--NVQYTRIAVDSVQGV 378
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 113682328 442 DGH-YNVLFIGTDNSVVLKMITIYNKEADTVEEVlleelQVFKVPVPITEILISTKRQQLYVGSELGV 508
Cdd:cd11256  379 SGHnYTVMFLGTDKGFLHKAVLMGGSESHIIEEI-----ELLTPPEPVENLLLAANEGVVYIGYSAGV 441
Sema_2A cd11238
The Sema domain, a protein interacting module, of semaphorin 2A (Sema2A); Sema2A, a secreted ...
57-511 8.61e-70

The Sema domain, a protein interacting module, of semaphorin 2A (Sema2A); Sema2A, a secreted semaphorin, signals through its receptor plexin B (PlexB) to regulate central and peripheral axon pathfinding. In the Drosophila embryo, Sema2A secreted by oenocytes interacts with PlexB to guide sensory axons. Sema2A is a member of the semaphorin family of proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200499 [Multi-domain]  Cd Length: 452  Bit Score: 237.71  E-value: 8.61e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  57 TMLLDETQERLIIGGKDVLYSLNLERI---TAPHKRIVWSSSQEQVEDCLMQG-REKPECANYIKLVQHYNS-THLLACG 131
Cdd:cd11238    5 TLLLDEKRNALYVGAMDRVFRLNLYNIndtGNNCARDELTLSPSDVSECVSKGkDEEYECRNHVRVIQPMGDgQTLYVCS 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 132 TGAFSPVCAYIRVSrgAEQEREFRLEsdhIESGRGRVPFHPN-SPLASTVYRGE------LFVGLYTDYWENDAALYR-- 202
Cdd:cd11238   85 TNAMNPKDRVLDAN--LLHLPEYVPG---PGNGIGKCPYDPDdNSTAVWVEWGNpgdlpaLYSGTRTEFTKANTVIYRpp 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 203 LGN------HSFIRTEVGDRQQLNEPKFVGSAVIpdnddpaDDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRM 276
Cdd:cd11238  160 LYNntkgrhESFMRTLKYDSKWLDEPNFVGSFDI-------GDYVYFFFRETAVEYINCGKVVYSRVARVCKKDTGGKNV 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 277 LVNRWSSFLKTRLICSVAG--PngidTHFDELEDVFVLRKKDEKnpEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFN-GP 353
Cdd:cd11238  233 LRQNWTTFLKARLNCSISGefP----FYFNEIQSVYKVPGRDDT--LFYATFTTSENGFTGSAVCVFTLSDINAAFDtGK 306
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 354 FAHRERTDHHW-KVYDGKVPYPRPGSCAskingghfSSSKEYSDEVLRFARSHPLMFQAVQpvHRRPILldTEGGRKLTQ 432
Cdd:cd11238  307 FKEQASSSSAWlPVLSSEVPEPRPGTCV--------NDSATLSDTVLHFARTHPLMDDAVS--HGPPLL--YLRDVVFTH 374
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 113682328 433 LAVDRVEAEDGHYNVLFIGTDNSVVLKMITIynKEADTVEEVLLEELQVfKVPVPITEILIStKRQQLYVGSELGVTQI 511
Cdd:cd11238  375 LVVDKLRIDDQEYVVFYAGSNDGKVYKIVHW--KDAGESKSNLLDVFEL-TPGEPIRAMELL-PGEFLYVASDHRVSQI 449
Sema_6C cd11268
The Sema domain, a protein interacting module, of semaphorin 6C (Sema6C, also called ...
67-482 3.07e-66

The Sema domain, a protein interacting module, of semaphorin 6C (Sema6C, also called semaphorin Y); Sema6C is highly expressed in adult brain and skeletal muscle and it shows growth cone collapsing activity. It may play a role in the maintenance and remodelling of neuronal connections. In adult skeletal muscle, this role includes prevention of motor neuron sprouting and uncontrolled motor neuron growth. The expression of Sema6C in adult skeletal muscle is down-regulated following denervation. Sema6C is a member of the class 6 semaphorin family of proteins, which are membrane associated semaphorins. Semaphorins are regulatory molecules involved in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200529 [Multi-domain]  Cd Length: 465  Bit Score: 228.43  E-value: 3.07e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  67 LIIGGKDVLYSLNLE-----RITAPHKRIVWSSsqEQVEDCLMQGREKPECANYIKLVQHYNSTHLLACGTGAFSPVCAY 141
Cdd:cd11268   21 LLVAARDHVFSFDLQaeeegEGLVPNKYLTWRS--QDVENCAVRGKLTDECYNYIRVLVPWDSQTLLACGTNSFSPVCRS 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 142 IRVSRGAEQEREFrlesdhieSGRGRVPFHPNSPLASTVYRGELFVGLYTDYWENDAALYR-LGNHSFIRTEVGDRQQLN 220
Cdd:cd11268   99 YGITSLQQEGEEL--------SGQARCPFDATQSNVAIFAEGSLYSATAADFQASDAVVYRsLGPQPPLRSAKYDSKWLR 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 221 EPKFVGSAvipdnddPADDKVYYFFTE-RVADVEGGnKAVYTRVARVCANDQGGQ-RMLVNRWSSFLKTRLICSVAGPNG 298
Cdd:cd11268  171 EPHFVQAL-------EHGDHVYFFFREvSVEDARLG-RVQFSRVARVCKRDMGGSpRALDRHWTSFLKLRLNCSVPGDST 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 299 IdtHFDELEdVFVLRKKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWK-VYDGKVPYPRPG 377
Cdd:cd11268  243 F--YFDVLQ-ALTGPVNLHGRSALFGVFTTQTNSIPGSAVCAFYLDEIERGFEGKFKEQRSLDGAWTpVSEDRVPSPRPG 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 378 SCASKINGGHFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLDTEGGRkLTQLAVDRVEAEDGHYNVLFIGTDNSVV 457
Cdd:cd11268  320 SCAGVGGAALFSSSRDLPDDVLTFIKAHPLLDPAVPPVTHQPLLTLTSRAL-LTQVAVDGMAGPHSNITVMFLGSNDGTV 398
                        410       420
                 ....*....|....*....|....*
gi 113682328 458 LKMITIYNKEADTvEEVLLEELQVF 482
Cdd:cd11268  399 LKVLPPGGRSGGP-EPILLEEIDAY 422
Sema_5A cd11263
The Sema domain, a protein interacting module, of semaphorin 5A (Sema5A); Originally, mouse ...
46-511 3.43e-65

The Sema domain, a protein interacting module, of semaphorin 5A (Sema5A); Originally, mouse Sema5A was identified as a protein that induces inhibitory responses during optic nerve development. Recent studies show that Sema5A controls innate immunity in mice. It also has been identified as a candidate gene for causing idiopathic autism in humans. Plexin B3 functions as a binding partner and receptor for Sema5A. Furthermore, Sema5A is also implicated in cancer. The role of the Drosophila Sema5A ortholog, Dsema-5C, in tumorigenicity and metastasis has been reported. Sema5A is highly expressed in human pancreatic cancer cells and is associated with tumor growth, invasion and metastasis. Sema5A belongs to class 5 semaphorin family of proteins, which are transmembrane glycoproteins characterized by unique thrombospondin specific repeats in the extracellular region of the protein. Semaphorins are regulatory molecules involved in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200524  Cd Length: 436  Bit Score: 224.52  E-value: 3.43e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  46 FQAgEGRLQQYTMLLDETQERLIIGGKDVLYSLNLERITAPhKRIVWSSSQEQVEDCLMQGREKPECANYIKlVQHYNST 125
Cdd:cd11263    1 FRA-ENAVDFSQLTFDPGQKELIVGARNYLFRLQLEDLSLI-QAVEWECDEATKKACYSKGKSKEECQNYIR-VLLVGGD 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 126 HLLACGTGAFSPVCAYIRVSRGAEQErefrlesDHIeSGRGRVPFHP--NSP--LASTvyrGELFVGLYTDYWENDAALY 201
Cdd:cd11263   78 RLFTCGTNAFTPICTNRTLNNLTEIH-------DQI-SGMARCPYSPqhNSTalLTSS---GELYAATAMDFPGRDPAIY 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 202 R-LGNHSFIRTEVGDRQQLNEPKFVGSAVIpdnddpaDDKVYYFFTERVADVEGGnKAVYTRVARVCANDQGGQRMLVNR 280
Cdd:cd11263  147 RsLGILPPLRTAQYNSKWLNEPNFVSSYDI-------GNFTYFFFRENAVEHDCG-KTVFSRAARVCKNDIGGRFLLEDT 218
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 281 WSSFLKTRLICSVagPNGIDTHFDELEDVFVLRKKDeknpEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERT 360
Cdd:cd11263  219 WTTFMKARLNCSR--PGEIPFYYNELQSTFFLPELD----LIYGIFTTNVNSIAASAVCVFNLSAISQAFNGPFKYQENS 292
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 361 DHHWkvydgkVPYPRPG---SCASKINGGHFSsskeYSDEVLRFARSHPLMFQAVQPVHRRPILLdtEGGRKLTQLAVDR 437
Cdd:cd11263  293 RSAW------LPYPNPNpnfQCGTMDQGLYVN----LTERNLQDAQKFILMHEVVQPVTPVPYFM--EDNSRFSHVAVDV 360
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 113682328 438 VEAEDGHYNVLFIGTDNSVVLKMITIYNKEADTveeVLLEELQVF--KVPVPITEILISTKRQQLYVGSELGVTQI 511
Cdd:cd11263  361 VQGKDMLFHIIYLATDYGTIKKVLAPLNQSSSS---CLLEEIELFpkRQREPIRSLQILHSQSVLFVGLQEHVIKI 433
Sema_5B cd11264
The Sema domain, a protein interacting module, of semaphorin 5B (Sema5B); Sema5B is expressed ...
53-511 4.09e-65

The Sema domain, a protein interacting module, of semaphorin 5B (Sema5B); Sema5B is expressed in regions of the basal telencephalon in rat. Sema5B is an inhibitory cue for corticofugal axons and acts as a source of repulsion for the appropriate guidance of cortical axons away from structures such as the ventricular zone as they navigate toward and within subcortical regions. In addition to its role as a guidance cue, Sema5B regulates the development and maintenance of synapse size and number in hippocampal neurons. In addition, the sema domain of Sema5B can be cleaved of the whole protein and exerts its function in regulation of synapse morphology. Sema5B belongs to the class 5 semaphorin family of proteins, which are transmembrane glycoproteins characterized by unique thrombospondin specific repeats in the extracellular region of the protein. Semaphorins are regulatory molecules involved in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200525  Cd Length: 437  Bit Score: 224.48  E-value: 4.09e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  53 LQQYTML-LDETQERLIIGGKDVLYSLNLERITAPhKRIVWSSSQEQVEDCLMQGREKPECANYIKlVQHYNSTHLLACG 131
Cdd:cd11264    6 VRDFSQLaLDLNRNQLIVGARNYLFRLSLHNVSLI-QATEWGSDEDTRRSCQSKGKTEEECQNYVR-VLIVYGKKVFTCG 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 132 TGAFSPVCAyirvsrgaeqEREFRLESDHIE--SGRGRVPFHP-NSPLASTVYRGELFVGLYTDYWENDAALYR-LGNHS 207
Cdd:cd11264   84 TNAFSPVCT----------SRQVGNLSKVIEriNGVARCPYDPrHNSTAVITSRGELYAATVIDFSGRDPAIYRsLGSVP 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 208 FIRTEVGDRQQLNEPKFVGSAVIpdnddpaDDKVYYFFTERVADVEGGnKAVYTRVARVCANDQGGQRMLVNRWSSFLKT 287
Cdd:cd11264  154 PLRTAQYNSKWLNEPNFIAAYDI-------GLFTYFFFRENAVEHDCG-KTVYSRVARVCKNDIGGRFLLEDTWTTFMKA 225
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 288 RLICSVAGPngIDTHFDELEDVFVLRKKDeknpEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPFAHRERTDHHWKVY 367
Cdd:cd11264  226 RLNCSRPGE--IPFYYNELQSTFYLPEQD----LIYGVFTTNVNSIAASAVCAFNLSAITQAFNGPFRYQENPRSAWLPT 299
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 368 DGKVPYPRPGSCASKingghfSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILldTEGGRKLTQLAVDRVEAEDGHYNV 447
Cdd:cd11264  300 ANPIPNFQCGTLSDD------SPNENLTERSLQDAQRLFLMNDVVQPVTVDPLV--TQDSVRFSKLVVDIVQGKDTLYHV 371
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 113682328 448 LFIGTDNSVVLKMITIYNKeadTVEEVLLEELQVFKVPV--PITEILISTKRQQLYVGSELGVTQI 511
Cdd:cd11264  372 MYIGTEYGTILKALSTTNR---SLRSCYLEEMQILPPGQrePIRSLQILHSDRSLFVGLNNGVLKI 434
Sema_7A cd11243
The Sema domain, a protein interacting module, of semaphorin 7A (Sema7A, also called CD108); ...
54-511 3.65e-57

The Sema domain, a protein interacting module, of semaphorin 7A (Sema7A, also called CD108); Sema7A plays regulatory roles in both immune and nervous systems. Unlike other semaphorins, which act as repulsive guidance cues, Sema7A enhances central and peripheral axon growth and is required for proper axon tract formation during embryonic development. Sema7A also plays a critical role in the negative regulation of T cell activation and function. Sema7A is a membrane-anchored member of the semaphorin family of proteins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems and cancer. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a receptor-recognition and -binding module.


Pssm-ID: 200504  Cd Length: 414  Bit Score: 201.23  E-value: 3.65e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  54 QQYTMLLDET-QERLIIGGKDVLYSLNLERITAPHKRIVWSSSQEQVEDClmqgREKPECANYIKLVQHYNSThLLACGT 132
Cdd:cd11243    2 ESYPVFFHEAgSSSVYVGGQGALYLLDFTGSAVIVKKIPDEKTEKDCKKR----ATLDDCENYITLIKKLDYR-LLVCGT 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 133 GAFSPVCAYIrvsrgAEQEREfrlesdHIESGRGRVPFHPNSPLASTVYRGELFVGLyTDYWENDAALYRLGNHSFIRTE 212
Cdd:cd11243   77 NAGSPKCWFL-----VNQTLV------TLSADRGVAPFLPDENSLVLIEGNNVYSTI-SGKKGNIPRFRRYGGKKELYTS 144
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 213 VGDRQQlnePKFVGSAVIPdNDDPADDKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRML-VNRWSSFLKTRLIC 291
Cdd:cd11243  145 DTVMQK---PQFVKATLLP-EDEQYQDKIYYFFREDNEDKGPEAEPNISRVARLCKEDQGGTSSLsTSKWSTFLKARLVC 220
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 292 SVAGPNGidtHFDELEDVFVLRKKDEKNPEIFGLFSTTsavFKGYAVCMYNMDDIRAAFngpfahreRTDHHWKvYDGKV 371
Cdd:cd11243  221 GDPATPM---NFNRLQDVFLLPKEEWREAVVYGVFSNT---WGSSAVCSYSLGDIDKVF--------RTSSLKG-YSGSL 285
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 372 PYPRPGSCaskingghFSSSKEYSDEVLRFARSHPLMFQAVQPVHRRPILLdTEGGRKLTQLAVDRVEAEDGH-YNVLFI 450
Cdd:cd11243  286 PNPRPGTC--------VPPEQTHPSETFSFADEHPELDDRIEPDEPRKLPV-FQNKDHYQKVVVDEVRASDGVsYDVLYL 356
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 113682328 451 GTDNSVVLKMITiynkeaDTVEEVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQI 511
Cdd:cd11243  357 ATDKGKIHKVVE------SKGQTHNIMEIQPFKEQEPIQSMILDAERSHLYVGTKAEVTRL 411
Sema cd09295
The Sema domain, a protein interacting module, of semaphorins and plexins; Both semaphorins ...
58-513 1.87e-45

The Sema domain, a protein interacting module, of semaphorins and plexins; Both semaphorins and plexins have a Sema domain on their N-termini. Plexins function as receptors for the semaphorins. Evolutionarily, plexins may be the ancestor of semaphorins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems, and cancer. Semaphorins can be divided into 7 classes. Vertebrates have members in classes 3-7, whereas classes 1 and 2 are known only in invertebrates. Class 2 and 3 semaphorins are secreted; classes 1 and 4 through 6 are transmembrane proteins; and class 7 is membrane associated via glycosylphosphatidylinositol (GPI) linkage. Plexins are a large family of transmembrane proteins, which are divided into four types (A-D) according to sequence similarity. In vertebrates, type A plexins serve as co-receptors for neuropilins to mediate the signalling of class 3 semaphorins. Plexins serve as direct receptors for several other members of the semaphorin family: class 6 semaphorins signal through type A plexins and class 4 semaphorins through type B plexins. This family also includes the MET and RON receptor tyrosine kinases. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves to recognize and bind receptors.


Pssm-ID: 200495 [Multi-domain]  Cd Length: 392  Bit Score: 167.38  E-value: 1.87e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  58 MLLDETQERLIIGGKDVLYSLNLERITAPHKRIV----WSSSQEQVEDCLMQGREKPECANYIKLVQHYNS-THLLACGT 132
Cdd:cd09295    5 ILVSFRKDTIYVGAIARIYKVDGGGTRLLLSCISpelnFGFNEDQKAFCPLRRGKWTECINYIKVLQQKGDlDILAVCGS 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 133 GAFSPVCAYIRVsrgaeqEREFRLESDHIESGRGRVPFHPNSPLASTVYRGELFVGLYTDYWEND-AALY-RLGNHSFIR 210
Cdd:cd09295   85 NAAQPSCGSYRL------DVLVELGKVRWPSGRPRCPIDNKHSNMGVNVDSKLYSATDHDFKDGDrPALSrRSSNVHYLR 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 211 TEVGDRQQLNEPKFVGSAVIPDNDDpaddKVYYFFTERVADVEGGNKAVYTRVARVCANDQGGQRMLVNRWSSFLKTRLI 290
Cdd:cd09295  159 IVVDSSTGLDEITFVYAFVSGDDDD----EVYFFFRQEPVEYLKKGMVYVPRIARVCKLDVGGCHRLKKKLTSFLKADLN 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 291 CSVAGPngiDTHFDELEDVFVLRkKDEKNPEIFGLFSTTSAVFKGYAVCMYNMDDIRAAFNGPfahrertdhhwkvydgk 370
Cdd:cd09295  235 CSRPQS---GFAFNLLQDATGDT-KNLIQDVKFAIFSSCLNKSVESAVCAYLFTDINNVFDDP----------------- 293
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 371 vpyprpgscaskingghfssskeysdevlrfarshplmfqaVQPVHRRPILLDTEGGRKLTQLAVDRVEAEDGHYNVLFI 450
Cdd:cd09295  294 -----------------------------------------VEAINNRPLYAHQNQRSRLTSIAVDATKQKSVGYQVVFL 332
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 113682328 451 GTDNSVVLKMITiynKEAdTVEEVLLEELQVFKVPVPITEILISTKRQQLYVGSELGVTQIRV 513
Cdd:cd09295  333 GLKLGSLGKALA---FFF-LYKGHIIEEWKVFKDSSRITNLDLSRPPLYLYVGSESGVLGVPV 391
Ig_Semaphorin_C cd04979
Immunoglobulin (Ig)-like domain of semaphorin; Ig_Semaphorin_C; Immunoglobulin (Ig)-like ...
580-668 2.07e-26

Immunoglobulin (Ig)-like domain of semaphorin; Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.


Pssm-ID: 143180  Cd Length: 89  Bit Score: 104.40  E-value: 2.07e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 580 ISEKLVYGVENNSTLLECRPRSLQASVTWYIEHGLDMEEVKSDDRMIQTPHGLLLLRIMKSDAGVYVCQSTEHGFIQTLL 659
Cdd:cd04979    1 AEEKVVTVVEGNSVFLECSPKSNLASVVWLFQGGPLQRKEEPEERLLVTEDGLLIRSVSPADAGVYTCQSVEHGFKQTLA 80

                 ....*....
gi 113682328 660 RVTLEVLEE 668
Cdd:cd04979   81 TYSLNVLEV 89
Sema_plexin_like cd11236
The Sema domain, a protein interacting module, of Plexins and MET-like receptor tyrosine ...
57-514 1.95e-12

The Sema domain, a protein interacting module, of Plexins and MET-like receptor tyrosine kinases; Plexins form a conserved family of transmembrane receptors for semaphorins and may be the ancestor of semaphorins. Ligand binding activates signal transduction pathways controlling axon guidance in the nervous system and other developmental processes including cell migration and morphogenesis, immune function, and tumor progression. Plexins are divided into four types (A-D) according to sequence similarity. In vertebrates, type A Plexins serve as the co-receptors for neuropilins to mediate the signalling of class 3 semaphorins except Sema3E, which signals through Plexin D1. Plexins serve as direct receptors for several other members of the semaphorin family: class 6 semaphorins signal through type A plexins and class 4 semaphorins through type B. Plexin C1 serves as the receptor of Sema7A and plays regulation roles in both immune and nervous systems. This family also includes the Met and RON receptor tyrosine kinases. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a ligand-recognition and -binding module.


Pssm-ID: 200497 [Multi-domain]  Cd Length: 401  Bit Score: 68.51  E-value: 1.95e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328  57 TMLLDETQERLIIGGKDVLYSLN------LERITAPhkriVWSSSQEQVEDCLMQGREKPECANYIKLVQ-HYNSTHLLA 129
Cdd:cd11236    4 HLAVDNSTGRVYVGAVNRLYQLDssllleAEVSTGP----VLDSPLCLPPGCCSCDHPRSPTDNYNKILLiDYSSGRLIT 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 130 CGTgafspvcayirVSRGAEQEREF-RLESDHIESGRGRVPFHPNSPLASTVYRGE------LFVGL-YTDYWendaalY 201
Cdd:cd11236   80 CGS-----------LYQGVCQLRNLsNISVVVERSSTPVAANDPNASTVGFVGPGPynnenvLYVGAtYTNNG------Y 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 202 RLGNHSFIRTEVGDRQQLNEPKFVGSAVIPDNDDPAD----DKVY--------YFFTERVADVeGGNKAVYTRVARVCAN 269
Cdd:cd11236  143 RDYRPAVSSRSLPPDDDFNAGSLTGGSAISIDDEYRDrysiKYVYgfssggfsYFVTVQRKSV-DDESPYISRLVRVCQS 221
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 270 DqggqrmlvNRWSSFLKTRLICsvAGPNGidTHFDELEDVFV------LRKKDEKNPE---IFGLFSTTSAVFKGY---- 336
Cdd:cd11236  222 D--------SNYYSYTEVPLQC--TGGDG--TNYNLLQAAYVgkagsdLARSLGISTDddvLFGVFSKSKGPSAEPssks 289
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 337 AVCMYNMDDIRAAFNgpfahrertdhhwkvydgkvpyprpgscaskingghfssskeysdevlrfaRSHPLmfQAVQPVH 416
Cdd:cd11236  290 ALCVFSMKDIEAAFN---------------------------------------------------DNCPL--GGGVPIT 316
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 417 RRPILLDTeggrKLTQLAVDRVEAedghYNVLFIGTDNSvVLKMITIYNKEADTVEevllEELQVFKVPVPITEILISTK 496
Cdd:cd11236  317 TSAVLSDS----LLTSVAVTTTRN----HTVAFLGTSDG-QLKKVVLESSSSATQY----ETLLVDSGSPILPDMVFDPD 383
                        490
                 ....*....|....*...
gi 113682328 497 RQQLYVGSELGVTQIRVH 514
Cdd:cd11236  384 GEHLYVMTPKKVTKVPVE 401
Sema_plexin_A2 cd11272
The Sema domain, a protein interacting module, of Plexin A2; Plexin A2 serves as a receptor ...
445-543 8.43e-09

The Sema domain, a protein interacting module, of Plexin A2; Plexin A2 serves as a receptor for class 6 semaphorins. Interactions between Plexin A2, A4 and semaphorins 6A and 6B control the lamina-restricted projection of hippocampal mossy fibers. Sema6B also repels the growth of mossy fibers in a Plexin A4 dependent manner. Plexin A2 does not suppress Sema6B function. In addition, studies have shown that Plexin A2 may be related to anxiety and other psychiatric disorders. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves as a ligand-recognition and -binding module.


Pssm-ID: 200533 [Multi-domain]  Cd Length: 515  Bit Score: 57.25  E-value: 8.43e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 445 YNVLFIGTDNSVVLKMitiynkEADTVEE--VLLEELQVFKVPVPI-TEILISTKRQQLYVGSELGVTQIRVHQCGLYgS 521
Cdd:cd11272  406 YSVVFVGTKSGKLKKI------RADGPPHggVQYEMVSVFKDGSPIlRDMAFSIDHKYLYVMSERQVSRVPVESCEQY-T 478
                         90       100
                 ....*....|....*....|....
gi 113682328 522 ACADCCLARDPYCAWDGF--TCSR 543
Cdd:cd11272  479 TCGECLSSGDPHCGWCALhnMCSR 502
Sema cd09295
The Sema domain, a protein interacting module, of semaphorins and plexins; Both semaphorins ...
238-575 4.74e-06

The Sema domain, a protein interacting module, of semaphorins and plexins; Both semaphorins and plexins have a Sema domain on their N-termini. Plexins function as receptors for the semaphorins. Evolutionarily, plexins may be the ancestor of semaphorins. Semaphorins are regulatory molecules in the development of the nervous system and in axonal guidance. They also play important roles in other biological processes, such as angiogenesis, immune regulation, respiration systems, and cancer. Semaphorins can be divided into 7 classes. Vertebrates have members in classes 3-7, whereas classes 1 and 2 are known only in invertebrates. Class 2 and 3 semaphorins are secreted; classes 1 and 4 through 6 are transmembrane proteins; and class 7 is membrane associated via glycosylphosphatidylinositol (GPI) linkage. Plexins are a large family of transmembrane proteins, which are divided into four types (A-D) according to sequence similarity. In vertebrates, type A plexins serve as co-receptors for neuropilins to mediate the signalling of class 3 semaphorins. Plexins serve as direct receptors for several other members of the semaphorin family: class 6 semaphorins signal through type A plexins and class 4 semaphorins through type B plexins. This family also includes the MET and RON receptor tyrosine kinases. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. It serves to recognize and bind receptors.


Pssm-ID: 200495 [Multi-domain]  Cd Length: 392  Bit Score: 48.36  E-value: 4.74e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 238 DDKVYYFFTErvadveggnKAVY-TRVARVCANDQGGqrmlvnrwSSFLKTRLICSVAgpngidTHFDELEDVFVLRKKD 316
Cdd:cd09295    2 DDKILVSFRK---------DTIYvGAIARIYKVDGGG--------TRLLLSCISPELN------FGFNEDQKAFCPLRRG 58
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 317 EKNPEI-FGLFSTTSAVFKGYAVCMYNMddiraaFNGPFAHRERTDhhwKVYDGKV--PYPRPGSCASKingghFSSSKE 393
Cdd:cd09295   59 KWTECInYIKVLQQKGDLDILAVCGSNA------AQPSCGSYRLDV---LVELGKVrwPSGRPRCPIDN-----KHSNMG 124
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 394 Y-SDEVLRFARSHPLMFQAvqpvhrRPILLDTEGGRKLTQLAVDRVEA-EDGHYNVLFIGTDNSvvlkmitiynkeadtv 471
Cdd:cd09295  125 VnVDSKLYSATDHDFKDGD------RPALSRRSSNVHYLRIVVDSSTGlDEITFVYAFVSGDDD---------------- 182
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113682328 472 eevllEELQVFKVPVPITEilisTKRQQLYVGSELGVTQIRVHQCGLYgSACADCCLARDPYCAWDGftCSRYYP--AGL 549
Cdd:cd09295  183 -----DEVYFFFRQEPVEY----LKKGMVYVPRIARVCKLDVGGCHRL-KKKLTSFLKADLNCSRPQ--SGFAFNllQDA 250
                        330       340
                 ....*....|....*....|....*.
gi 113682328 550 YTKRRFRRQDVRHGNAVQQCNGLQLS 575
Cdd:cd09295  251 TGDTKNLIQDVKFAIFSSCLNKSVES 276
Ig_Sema4B_like cd05872
Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B; Ig_Sema4B_like; ...
590-668 6.13e-06

Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B; Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.


Pssm-ID: 143280  Cd Length: 85  Bit Score: 45.11  E-value: 6.13e-06
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 113682328 590 NNSTLLECRPRSLQASVTWYIEHGldmeEVKSDDRMIQTPHGLLLLRIMKSDAGVYVCQSTEHGFIQTLLRVTLEVLEE 668
Cdd:cd05872   11 GADVVLPCQLRSNLASPVWLFNGT----PLNAQFSYRVGTDGLLILVTSPEHSGTYRCYSEEEGFQQLVASYSLNVVEQ 85
PSI smart00423
domain found in Plexins, Semaphorins and Integrins;
515-563 2.99e-05

domain found in Plexins, Semaphorins and Integrins;


Pssm-ID: 214655  Cd Length: 47  Bit Score: 42.53  E-value: 2.99e-05
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 113682328   515 QCGLYGSaCADCCLARDPYCAWDGFT--CSRYYPAGLytkrrfRRQDVRHG 563
Cdd:smart00423   1 RCSKYTS-CSECLLARDPYCAWCSSQgrCTSGERCDS------RRQNWLSG 44
PSI pfam01437
Plexin repeat; A cysteine rich repeat found in several different extracellular receptors. The ...
516-543 2.17e-03

Plexin repeat; A cysteine rich repeat found in several different extracellular receptors. The function of the repeat is unknown. Three copies of the repeat are found Plexin. Two copies of the repeat are found in mahogany protein. A related C. elegans protein contains four copies of the repeat. The Met receptor contains a single copy of the repeat. The Pfam alignment shows 6 conserved cysteine residues that may form three conserved disulphide bridges, whereas shows 8 conserved cysteines. The pattern of conservation suggests that cysteines 5 and 7 (that are not absolutely conserved) form a disulphide bridge (Personal observation. A Bateman).


Pssm-ID: 250622  Cd Length: 48  Bit Score: 37.14  E-value: 2.17e-03
                          10        20        30
                  ....*....|....*....|....*....|
gi 113682328  516 CGLYGSaCADCCLARDPYCAWDG--FTCSR 543
Cdd:pfam01437   2 CSQYTS-CSSCLAARDPYCGWCSseGRCTR 30
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH