NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|113676373|ref|NP_001038360.1|]
View 

sodium channel protein type 2 subunit alpha

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1465-1517 4.30e-31

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


:

Pssm-ID: 240441  Cd Length: 54  Bit Score: 118.82  E-value: 4.30e-31
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 113676373 1465 DNFNQQKKKLGG-QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGLVFD 1517
Cdd:cd13433     1 DNFNQLKKKYGGgLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
980-1209 4.21e-98

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


:

Pssm-ID: 253777  Cd Length: 230  Bit Score: 317.40  E-value: 4.21e-98
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   980 DSEMNNLQIAVGRIQKGIALVKSTLRQFLQSLFlaGSKPRSLNEE-KPLDDLHSDGKENCLSNHapvavdltkdYLKEGC 1058
Cdd:pfam06512    1 DGEMNNLQIAIARIQRGINWVKRNIRDFFKKLL--KKKPKEIDEQtEAEDNLLDKAVDDILSNH----------YLKEGN 68
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1059 ----VSPGNGVESHVKYGIEEGDYMSFIHNPSLTVTVPIAVGESDFENLNTEDFSSESSD--VEGSKEKLPVDTVL---- 1128
Cdd:pfam06512   69 gttsVAIGDGMEKTIHGDVKESDPMSFITNPSLTVSVPIASGESDLENLNDEDTSSESSYgfKEESKKGSAETLKLeekd 148
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1129 -SSSEGSTVDIRPPGEGAESVELEPEESLDPEACFTEGCVMRFQCCQVDVEKGKWKSWWILRKTCFIIVEHNWFESFIIF 1207
Cdd:pfam06512  149 sSSSEGSTVDLEPPEEEEEEIAEEEEEVKEPEDCFPEGCVRRFPCCAVDIDSGFGKGWWNLRKTCYQIVEHSWFETFIIF 228

                   ..
gi 113676373  1208 MI 1209
Cdd:pfam06512  229 MI 230
DUF3451 pfam11933
Domain of unknown function (DUF3451); This presumed domain is functionally uncharacterized. ...
504-693 3.09e-65

Domain of unknown function (DUF3451); This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 199 to 238 amino acids in length. This domain is found associated with pfam06512, pfam00520. This domain has a conserved ADD sequence motif.


:

Pssm-ID: 256738  Cd Length: 222  Bit Score: 223.13  E-value: 3.09e-65
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   504 DQEKFHKSASEDSIRRPGFRfsidanrLSYEKKCstpNQSLLSIRGSLFSPRRNSRASLFSFRGRARDFGSENDFADDEH 583
Cdd:pfam11933   34 DSEKEPKSESADGRKRCRFL-------LRKTRKV---SQSLLSLPGSPFNTRRGSRGSIFSFRGRGRDVGSENDFADDEN 103
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   584 STFEDSDSrRGSLFVPRCVERRSSTVSHCSLtAPRI--MLPANGKMHCTVDCNGVVSLVGGTSVPTSPIGRLLPE----- 656
Cdd:pfam11933  104 SVTEMSES-RGSLFLPWRYERRSSHSSYTSH-SSRIfpKLTSNGKLLGTVDCNGVVSLTGEDVLRASPGGNLLPEctmek 181
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|.
gi 113676373   657 -GTTTESDVRKKRSGSHQPSDYLEETVA---RKRAMSVASI 693
Cdd:pfam11933  182 eGGTTDTEGKTHLRSLELSVDLLEEPVPgarRDRALSEVSA 222
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1235-1463 4.56e-52

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


:

Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 184.03  E-value: 4.56e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1235 YADKVFTYIFILEMLLKWVAYGFA-KYFTNAWCWLDFLIVDVSLVSLVANALGYSELSAIKSLRTLRALRPLRALSRFEG 1313
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGFKlSYFRSPWNILDFLVVLPSLVSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRFPG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1314 MRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYYYCVnitndelfpvsvvnnksdcyaliqnNDTARWKNVK 1393
Cdd:pfam00520   81 LRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCE-------------------------DENENPINGN 135
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1394 INFDNVGAGYLALLQVATFKGWMDIMYAAVDsrdleqqpvyETNLYMYLYFVIFIIFGSFFTLNLFIGVI 1463
Cdd:pfam00520  136 SNFDSYPEALLWLFRTLTTEGWGDIMPDTLD----------AGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1556-1766 5.86e-46

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


:

Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 166.69  E-value: 5.86e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1556 WINLVFIILFTGECVLKMISLR--HYFFTIGWNVFDFVVVILSIVGMFLSEMIEkyfVSPTLFRVIRLARIGRILRLIKG 1633
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGfkLSYFRSPWNILDFLVVLPSLVSLILRLLGE---GSEGLLSVLRLLRLLRLLRLLRR 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1634 AKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNLAYVKRE------AGIDDMFNFETFGNSMLCLFQITTSAGW 1707
Cdd:pfam00520   78 FPGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKcedeneNPINGNSNFDSYPEALLWLFRTLTTEGW 157
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 113676373  1708 DGLLAPILnkqdpdcdsemehpgsfyrgnCGNPSVGIFFFVSYIIICFLIVVNMYIAVI 1766
Cdd:pfam00520  158 GDIMPDTL---------------------DAGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
776-954 2.78e-43

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


:

Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 158.99  E-value: 2.78e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   776 VGNLVFTGIFTAEMCLKVIALDP-YYYFQEGWNIFDGIIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPT 849
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGFkLSYFRSPWNILDFLVVLPSLVSLILRLLGEgseglLSVLRLLRLLRLLRLLRRFPG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   850 LNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYRECVCKISEsCELPRWHMDDFFHSFLIVFRVLCGE-WIE 928
Cdd:pfam00520   81 LRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEDENEN-PINGNSNFDSYPEALLWLFRTLTTEgWGD 159
                          170       180
                   ....*....|....*....|....*.
gi 113676373   929 TMWDCMeVAGQSMCLIVFMMVMVIGN 954
Cdd:pfam00520  160 IMPDTL-DAGTVLGKIFFVIFIILGG 184
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
159-413 2.83e-43

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


:

Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 158.99  E-value: 2.83e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   159 VEYTFTGIYTFESLIKILARGFcvgKFTFLRDPWNWLDFSVILMAYVTEFVNL------GNVSALRTFRVLRALKTISVI 232
Cdd:pfam00520    2 LDYVFTVIFTLEMLLKFIALGF---KLSYFRSPWNILDFLVVLPSLVSLILRLlgegseGLLSVLRLLRLLRLLRLLRRF 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   233 PGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRQKCVKMpevnvtdnltdystelhnstfnwteyisds 312
Cdd:pfam00520   79 PGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEDEN------------------------------ 128
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   313 nnyyfipgrrdallcgnssdagqcpegftcikagRNPDYGYTSFDTFSWAFLSLFRLMTQDFWENLYQQTLRAAGKPYMI 392
Cdd:pfam00520  129 ----------------------------------ENPINGNSNFDSYPEALLWLFRTLTTEGWGDIMPDTLDAGTVLGKI 174
                          250       260
                   ....*....|....*....|.
gi 113676373   393 FFVLVIFLGSFYLVNLILAVV 413
Cdd:pfam00520  175 FFVIFIILGGFLLLNLLIGVI 195
 
Name Accession Description Interval E-value
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1465-1517 4.30e-31

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 118.82  E-value: 4.30e-31
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 113676373 1465 DNFNQQKKKLGG-QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGLVFD 1517
Cdd:cd13433     1 DNFNQLKKKYGGgLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
980-1209 4.21e-98

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 253777  Cd Length: 230  Bit Score: 317.40  E-value: 4.21e-98
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   980 DSEMNNLQIAVGRIQKGIALVKSTLRQFLQSLFlaGSKPRSLNEE-KPLDDLHSDGKENCLSNHapvavdltkdYLKEGC 1058
Cdd:pfam06512    1 DGEMNNLQIAIARIQRGINWVKRNIRDFFKKLL--KKKPKEIDEQtEAEDNLLDKAVDDILSNH----------YLKEGN 68
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1059 ----VSPGNGVESHVKYGIEEGDYMSFIHNPSLTVTVPIAVGESDFENLNTEDFSSESSD--VEGSKEKLPVDTVL---- 1128
Cdd:pfam06512   69 gttsVAIGDGMEKTIHGDVKESDPMSFITNPSLTVSVPIASGESDLENLNDEDTSSESSYgfKEESKKGSAETLKLeekd 148
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1129 -SSSEGSTVDIRPPGEGAESVELEPEESLDPEACFTEGCVMRFQCCQVDVEKGKWKSWWILRKTCFIIVEHNWFESFIIF 1207
Cdd:pfam06512  149 sSSSEGSTVDLEPPEEEEEEIAEEEEEVKEPEDCFPEGCVRRFPCCAVDIDSGFGKGWWNLRKTCYQIVEHSWFETFIIF 228

                   ..
gi 113676373  1208 MI 1209
Cdd:pfam06512  229 MI 230
DUF3451 pfam11933
Domain of unknown function (DUF3451); This presumed domain is functionally uncharacterized. ...
504-693 3.09e-65

Domain of unknown function (DUF3451); This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 199 to 238 amino acids in length. This domain is found associated with pfam06512, pfam00520. This domain has a conserved ADD sequence motif.


Pssm-ID: 256738  Cd Length: 222  Bit Score: 223.13  E-value: 3.09e-65
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   504 DQEKFHKSASEDSIRRPGFRfsidanrLSYEKKCstpNQSLLSIRGSLFSPRRNSRASLFSFRGRARDFGSENDFADDEH 583
Cdd:pfam11933   34 DSEKEPKSESADGRKRCRFL-------LRKTRKV---SQSLLSLPGSPFNTRRGSRGSIFSFRGRGRDVGSENDFADDEN 103
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   584 STFEDSDSrRGSLFVPRCVERRSSTVSHCSLtAPRI--MLPANGKMHCTVDCNGVVSLVGGTSVPTSPIGRLLPE----- 656
Cdd:pfam11933  104 SVTEMSES-RGSLFLPWRYERRSSHSSYTSH-SSRIfpKLTSNGKLLGTVDCNGVVSLTGEDVLRASPGGNLLPEctmek 181
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|.
gi 113676373   657 -GTTTESDVRKKRSGSHQPSDYLEETVA---RKRAMSVASI 693
Cdd:pfam11933  182 eGGTTDTEGKTHLRSLELSVDLLEEPVPgarRDRALSEVSA 222
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1235-1463 4.56e-52

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 184.03  E-value: 4.56e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1235 YADKVFTYIFILEMLLKWVAYGFA-KYFTNAWCWLDFLIVDVSLVSLVANALGYSELSAIKSLRTLRALRPLRALSRFEG 1313
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGFKlSYFRSPWNILDFLVVLPSLVSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRFPG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1314 MRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYYYCVnitndelfpvsvvnnksdcyaliqnNDTARWKNVK 1393
Cdd:pfam00520   81 LRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCE-------------------------DENENPINGN 135
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1394 INFDNVGAGYLALLQVATFKGWMDIMYAAVDsrdleqqpvyETNLYMYLYFVIFIIFGSFFTLNLFIGVI 1463
Cdd:pfam00520  136 SNFDSYPEALLWLFRTLTTEGWGDIMPDTLD----------AGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1556-1766 5.86e-46

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 166.69  E-value: 5.86e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1556 WINLVFIILFTGECVLKMISLR--HYFFTIGWNVFDFVVVILSIVGMFLSEMIEkyfVSPTLFRVIRLARIGRILRLIKG 1633
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGfkLSYFRSPWNILDFLVVLPSLVSLILRLLGE---GSEGLLSVLRLLRLLRLLRLLRR 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1634 AKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNLAYVKRE------AGIDDMFNFETFGNSMLCLFQITTSAGW 1707
Cdd:pfam00520   78 FPGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKcedeneNPINGNSNFDSYPEALLWLFRTLTTEGW 157
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 113676373  1708 DGLLAPILnkqdpdcdsemehpgsfyrgnCGNPSVGIFFFVSYIIICFLIVVNMYIAVI 1766
Cdd:pfam00520  158 GDIMPDTL---------------------DAGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
776-954 2.78e-43

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 158.99  E-value: 2.78e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   776 VGNLVFTGIFTAEMCLKVIALDP-YYYFQEGWNIFDGIIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPT 849
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGFkLSYFRSPWNILDFLVVLPSLVSLILRLLGEgseglLSVLRLLRLLRLLRLLRRFPG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   850 LNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYRECVCKISEsCELPRWHMDDFFHSFLIVFRVLCGE-WIE 928
Cdd:pfam00520   81 LRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEDENEN-PINGNSNFDSYPEALLWLFRTLTTEgWGD 159
                          170       180
                   ....*....|....*....|....*.
gi 113676373   929 TMWDCMeVAGQSMCLIVFMMVMVIGN 954
Cdd:pfam00520  160 IMPDTL-DAGTVLGKIFFVIFIILGG 184
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
159-413 2.83e-43

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 158.99  E-value: 2.83e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   159 VEYTFTGIYTFESLIKILARGFcvgKFTFLRDPWNWLDFSVILMAYVTEFVNL------GNVSALRTFRVLRALKTISVI 232
Cdd:pfam00520    2 LDYVFTVIFTLEMLLKFIALGF---KLSYFRSPWNILDFLVVLPSLVSLILRLlgegseGLLSVLRLLRLLRLLRLLRRF 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   233 PGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRQKCVKMpevnvtdnltdystelhnstfnwteyisds 312
Cdd:pfam00520   79 PGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEDEN------------------------------ 128
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   313 nnyyfipgrrdallcgnssdagqcpegftcikagRNPDYGYTSFDTFSWAFLSLFRLMTQDFWENLYQQTLRAAGKPYMI 392
Cdd:pfam00520  129 ----------------------------------ENPINGNSNFDSYPEALLWLFRTLTTEGWGDIMPDTLDAGTVLGKI 174
                          250       260
                   ....*....|....*....|.
gi 113676373   393 FFVLVIFLGSFYLVNLILAVV 413
Cdd:pfam00520  175 FFVIFIILGGFLLLNLLIGVI 195
 
Name Accession Description Interval E-value
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1465-1517 4.30e-31

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 118.82  E-value: 4.30e-31
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 113676373 1465 DNFNQQKKKLGG-QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGLVFD 1517
Cdd:cd13433     1 DNFNQLKKKYGGgLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
980-1209 4.21e-98

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 253777  Cd Length: 230  Bit Score: 317.40  E-value: 4.21e-98
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   980 DSEMNNLQIAVGRIQKGIALVKSTLRQFLQSLFlaGSKPRSLNEE-KPLDDLHSDGKENCLSNHapvavdltkdYLKEGC 1058
Cdd:pfam06512    1 DGEMNNLQIAIARIQRGINWVKRNIRDFFKKLL--KKKPKEIDEQtEAEDNLLDKAVDDILSNH----------YLKEGN 68
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1059 ----VSPGNGVESHVKYGIEEGDYMSFIHNPSLTVTVPIAVGESDFENLNTEDFSSESSD--VEGSKEKLPVDTVL---- 1128
Cdd:pfam06512   69 gttsVAIGDGMEKTIHGDVKESDPMSFITNPSLTVSVPIASGESDLENLNDEDTSSESSYgfKEESKKGSAETLKLeekd 148
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1129 -SSSEGSTVDIRPPGEGAESVELEPEESLDPEACFTEGCVMRFQCCQVDVEKGKWKSWWILRKTCFIIVEHNWFESFIIF 1207
Cdd:pfam06512  149 sSSSEGSTVDLEPPEEEEEEIAEEEEEVKEPEDCFPEGCVRRFPCCAVDIDSGFGKGWWNLRKTCYQIVEHSWFETFIIF 228

                   ..
gi 113676373  1208 MI 1209
Cdd:pfam06512  229 MI 230
DUF3451 pfam11933
Domain of unknown function (DUF3451); This presumed domain is functionally uncharacterized. ...
504-693 3.09e-65

Domain of unknown function (DUF3451); This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 199 to 238 amino acids in length. This domain is found associated with pfam06512, pfam00520. This domain has a conserved ADD sequence motif.


Pssm-ID: 256738  Cd Length: 222  Bit Score: 223.13  E-value: 3.09e-65
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   504 DQEKFHKSASEDSIRRPGFRfsidanrLSYEKKCstpNQSLLSIRGSLFSPRRNSRASLFSFRGRARDFGSENDFADDEH 583
Cdd:pfam11933   34 DSEKEPKSESADGRKRCRFL-------LRKTRKV---SQSLLSLPGSPFNTRRGSRGSIFSFRGRGRDVGSENDFADDEN 103
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   584 STFEDSDSrRGSLFVPRCVERRSSTVSHCSLtAPRI--MLPANGKMHCTVDCNGVVSLVGGTSVPTSPIGRLLPE----- 656
Cdd:pfam11933  104 SVTEMSES-RGSLFLPWRYERRSSHSSYTSH-SSRIfpKLTSNGKLLGTVDCNGVVSLTGEDVLRASPGGNLLPEctmek 181
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|.
gi 113676373   657 -GTTTESDVRKKRSGSHQPSDYLEETVA---RKRAMSVASI 693
Cdd:pfam11933  182 eGGTTDTEGKTHLRSLELSVDLLEEPVPgarRDRALSEVSA 222
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1235-1463 4.56e-52

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 184.03  E-value: 4.56e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1235 YADKVFTYIFILEMLLKWVAYGFA-KYFTNAWCWLDFLIVDVSLVSLVANALGYSELSAIKSLRTLRALRPLRALSRFEG 1313
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGFKlSYFRSPWNILDFLVVLPSLVSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRFPG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1314 MRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYYYCVnitndelfpvsvvnnksdcyaliqnNDTARWKNVK 1393
Cdd:pfam00520   81 LRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCE-------------------------DENENPINGN 135
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1394 INFDNVGAGYLALLQVATFKGWMDIMYAAVDsrdleqqpvyETNLYMYLYFVIFIIFGSFFTLNLFIGVI 1463
Cdd:pfam00520  136 SNFDSYPEALLWLFRTLTTEGWGDIMPDTLD----------AGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1556-1766 5.86e-46

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 166.69  E-value: 5.86e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1556 WINLVFIILFTGECVLKMISLR--HYFFTIGWNVFDFVVVILSIVGMFLSEMIEkyfVSPTLFRVIRLARIGRILRLIKG 1633
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGfkLSYFRSPWNILDFLVVLPSLVSLILRLLGE---GSEGLLSVLRLLRLLRLLRLLRR 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1634 AKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNLAYVKRE------AGIDDMFNFETFGNSMLCLFQITTSAGW 1707
Cdd:pfam00520   78 FPGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKcedeneNPINGNSNFDSYPEALLWLFRTLTTEGW 157
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 113676373  1708 DGLLAPILnkqdpdcdsemehpgsfyrgnCGNPSVGIFFFVSYIIICFLIVVNMYIAVI 1766
Cdd:pfam00520  158 GDIMPDTL---------------------DAGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
776-954 2.78e-43

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 158.99  E-value: 2.78e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   776 VGNLVFTGIFTAEMCLKVIALDP-YYYFQEGWNIFDGIIVSLSLMELGLANVEG-----LSVLRSFRLLRVFKLAKSWPT 849
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGFkLSYFRSPWNILDFLVVLPSLVSLILRLLGEgseglLSVLRLLRLLRLLRLLRRFPG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   850 LNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYRECVCKISEsCELPRWHMDDFFHSFLIVFRVLCGE-WIE 928
Cdd:pfam00520   81 LRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEDENEN-PINGNSNFDSYPEALLWLFRTLTTEgWGD 159
                          170       180
                   ....*....|....*....|....*.
gi 113676373   929 TMWDCMeVAGQSMCLIVFMMVMVIGN 954
Cdd:pfam00520  160 IMPDTL-DAGTVLGKIFFVIFIILGG 184
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
159-413 2.83e-43

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 158.99  E-value: 2.83e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   159 VEYTFTGIYTFESLIKILARGFcvgKFTFLRDPWNWLDFSVILMAYVTEFVNL------GNVSALRTFRVLRALKTISVI 232
Cdd:pfam00520    2 LDYVFTVIFTLEMLLKFIALGF---KLSYFRSPWNILDFLVVLPSLVSLILRLlgegseGLLSVLRLLRLLRLLRLLRRF 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   233 PGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRQKCVKMpevnvtdnltdystelhnstfnwteyisds 312
Cdd:pfam00520   79 PGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEDEN------------------------------ 128
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373   313 nnyyfipgrrdallcgnssdagqcpegftcikagRNPDYGYTSFDTFSWAFLSLFRLMTQDFWENLYQQTLRAAGKPYMI 392
Cdd:pfam00520  129 ----------------------------------ENPINGNSNFDSYPEALLWLFRTLTTEGWGDIMPDTLDAGTVLGKI 174
                          250       260
                   ....*....|....*....|.
gi 113676373   393 FFVLVIFLGSFYLVNLILAVV 413
Cdd:pfam00520  175 FFVIFIILGGFLLLNLLIGVI 195
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
1553-1773 4.81e-09

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 254584 [Multi-domain]  Cd Length: 423  Bit Score: 59.28  E-value: 4.81e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1553 ILYWINLVFIILFTGECVLK-MISLRHYFFTIgWNVFDFVVVILSIVGMFLS--------EMIEKYFVSPTLF----RVI 1619
Cdd:pfam08016  210 LCEIIFLVFVLYFVVAEITKiRREGPRYLRSV-WNLLDLAIVALSVVVIVLHiyrdflatQLWKQVEASPVDFtdfdRVA 288
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1620 RLARIGRI-------LRLIKGAKGIRTL----LF--ALMMSLPALFNIGLLLFLVMFIYAIFGmsnlaYVKREAGIDdmf 1686
Cdd:pfam08016  289 RLDQLYRIilafllfLTWLKLFKVLRFNrtmsLFtkTLSRALKELLGFAVMFVILFLAYAQLG-----YLLFGSQVD--- 360
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113676373  1687 NFETFGNSMLCLFQITTSA-GWdgllapilnkqdpdcdSEMEHPGSFyrgncgnpsVGIFFFVSYIIICFLIVVNMYIAV 1765
Cdd:pfam08016  361 NFSNFVKSILTLFRTLCGDfGY----------------TEIFSGNRV---------LGPLLFLTFVFLVIFILLNLFLAI 415

                   ....*...
gi 113676373  1766 ILENFSVA 1773
Cdd:pfam08016  416 INDSYVEV 423
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH