NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|113477011|ref|YP_723072|]
View 

hypothetical protein Tery_3509 [Trichodesmium erythraeum IMS101]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc super family cl00120
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
17-257 4.38e-09

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


The actual alignment was detected with superfamily member cd00143:

Pssm-ID: 260203  Cd Length: 254  Bit Score: 56.18  E-value: 4.38e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  17 QGEDFQIA---EDYEQAIVIGVFDGLGGrilgtaketggriasRKVAEITKDILAESQGNLDQDRASEIKGKSCQILKE- 92
Cdd:cd00143   14 TNEDAVVIkpnLNNEDGGLFGVFDGHGG---------------HAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKa 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  93 FADKNlptSRIRGKLASKRLCSTIG---VASLFkrltdeQKYLVQIAWMGDSRIYYLHPHQgLQQLTKDDFKENKNALEV 169
Cdd:cd00143   79 FLRAD---EEILEEAQDEPDDARSGttaVVALI------RGNKLYVANVGDSRAVLCRNGE-AVQLTKDHKPVNEEERER 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 170 IYQ---------------------DLPMSKFLTADPDadweinYKEFEFSEEG-FIFACTDGCFQYLPaPWEFEKLLLKT 227
Cdd:cd00143  149 IEKaggrvsngrvpgvlavtralgDFDLKPGVSAEPD------VTVVKLTEDDdFLILASDGLWDVLS-NQEAVDIVRSE 221
                        250       260       270
                 ....*....|....*....|....*....|
gi 113477011 228 LIESNSMEEWQNLLTNFYKYNKYDDVTLLL 257
Cdd:cd00143  222 LAKEDLQEAAQELVDLALRRGSHDNITVVV 251
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
17-257 4.38e-09

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 56.18  E-value: 4.38e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  17 QGEDFQIA---EDYEQAIVIGVFDGLGGrilgtaketggriasRKVAEITKDILAESQGNLDQDRASEIKGKSCQILKE- 92
Cdd:cd00143   14 TNEDAVVIkpnLNNEDGGLFGVFDGHGG---------------HAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKa 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  93 FADKNlptSRIRGKLASKRLCSTIG---VASLFkrltdeQKYLVQIAWMGDSRIYYLHPHQgLQQLTKDDFKENKNALEV 169
Cdd:cd00143   79 FLRAD---EEILEEAQDEPDDARSGttaVVALI------RGNKLYVANVGDSRAVLCRNGE-AVQLTKDHKPVNEEERER 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 170 IYQ---------------------DLPMSKFLTADPDadweinYKEFEFSEEG-FIFACTDGCFQYLPaPWEFEKLLLKT 227
Cdd:cd00143  149 IEKaggrvsngrvpgvlavtralgDFDLKPGVSAEPD------VTVVKLTEDDdFLILASDGLWDVLS-NQEAVDIVRSE 221
                        250       260       270
                 ....*....|....*....|....*....|
gi 113477011 228 LIESNSMEEWQNLLTNFYKYNKYDDVTLLL 257
Cdd:cd00143  222 LAKEDLQEAAQELVDLALRRGSHDNITVVV 251
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
25-258 4.83e-08

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 53.13  E-value: 4.83e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  25 EDYEQAIVIGVFDGLGGRilgtakeTGGRIASRKVAEITKDilaesqgNLDQDRASEIKGKSCQILKEF---ADKNLptS 101
Cdd:COG0631   33 ENGNLLLLFAVADGMGGH-------AAGEVASKLAVEALAR-------LFDETNFNSLNESLEELLKEAilkANEAI--A 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 102 RIRGKLASKRLCSTIGVASLFKrltdEQKYlvQIAWMGDSRIYYLHPHQgLQQLTKDDfkENKNALEVIYQDLPM----- 176
Cdd:COG0631   97 EEGQLNEDVRGMGTTLVLLLIR----GNKL--YVANVGDSRAYLLRDGE-LKQLTEDH--SLVNRLEQRGIITPEearsh 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 177 ------SKFLTADPDAdwEINYKEFEFSEEGFIFACTDGCFQYLPAPwEFEKLLLKTLIESNSMEEWQNLLTNfykYNKY 250
Cdd:COG0631  168 prrnalTRALGDFDLL--EPDITELELEPGDFLLLCSDGLWDVVSDD-EIVDILKNSETPQEAADKLIELALE---GGGP 241

                 ....*...
gi 113477011 251 DDVTLLLY 258
Cdd:COG0631  242 DNITVVLV 249
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
26-244 7.56e-05

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 43.07  E-value: 7.56e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   26 DYEQAIVIGVFDGLGGRILGtakETGGRIASRKVAEITKDILAESQGNLDQDRASEIKGKSCQILKEFADknlptsriRG 105
Cdd:pfam13672  20 VLSDGWLIAVADGAGSAKYS---DVGARLAVEAAVEALRELLDSGELPELEALVRQILNDILALVRQEAA--------AQ 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  106 KLASKRLCSTIGVAslfkRLTDEQKYLVQIawmGDSRIYYLHPHQGLQQLTKDDFKENKNaleviyqdlpMSKFLT-ADP 184
Cdd:pfam13672  89 GLEPRDYATTLLLA----VITPGGIVFFQI---GDGAIVVRDRDGELQLLSEPDSGEYAN----------ETTFLTsPDA 151
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  185 DADWEInyKEFEFSEEGFIFACTDGCFQYLpAPWEFEKLLLKTLIESNSMEEWQNLLTNF 244
Cdd:pfam13672 152 LEEFRI--RRLTLEPGDALALMTDGLSDSL-VTEEPFFPFFAPLLETLEEEGASEQLAEF 208
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
17-257 2.24e-04

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 41.98  E-value: 2.24e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011    17 QGEDFQIAEDY--EQAIVIGVFDGLGGRIlgtaketggriASRKVAEITKDILAESQGNLDQDRaseikGKSCQILKE-F 93
Cdd:smart00332  22 PMEDAHVITPDlsDSGGFFGVFDGHGGSE-----------AAKFLSKNLPEILAEELIKEKDEL-----EDVEEALRKaF 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011    94 --ADKnlptsRIRGKLASKRLCSTIGVAslfkrLTDEQKYlvqIAWMGDSRIyYLHPHQGLQQLTKDDFKENKNALEVIY 171
Cdd:smart00332  86 lsTDE-----EILEELEALSGSTAVVAL-----ISGNKLY---VANVGDSRA-VLCRNGKAVQLTEDHKPSNEDERARIE 151
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   172 Q---------------------DLPMSKFLTADPDadweinYKEFEFSEEG-FIFACTDGCFQYLPapweFEKL--LLKT 227
Cdd:smart00332 152 AaggfvingrvngvlalsraigDFFLKPYVSAEPD------VTVVELTEKDdFLILASDGLWDVLS----NQEVvdIVRK 221
                          250       260       270
                   ....*....|....*....|....*....|
gi 113477011   228 LIESNSMEEWQNLLTNFYKYNKYDDVTLLL 257
Cdd:smart00332 222 HLSKDPKEAAKRLIDLALARGSKDNITVVV 251
2A1904 TIGR00927
K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying ...
348-613 1.13e-12

K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying compounds].


Pssm-ID: 233191 [Multi-domain]  Cd Length: 1096  Bit Score: 70.02  E-value: 1.13e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   348 ISAGALTEEKTEADETTEEISAGALTEEKTEADETTE-------EISAGALTEENTEADETTEEISAGALTEENTEADET 420
Cdd:TIGR00927  630 LSKGDVAEAEHTGERTGEEGERPTEAEGENGEESGGEaeqegetETKGENESEGEIPAERKGEQEGEGEIEAKEADHKGE 709
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   421 TEEISAGALTEENTEADETTEEISAGALTEEntEADETTEEISAGALTEEKTEADETTEEisagALTEEKTEADETTEEI 500
Cdd:TIGR00927  710 TEAEEVEHEGETEAEGTEDEGEIETGEEGEE--VEDEGEGEAEGKHEVETEGDRKETEHE----GETEAEGKEDEDEGEI 783
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   501 SAGALTEEK-TEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADettEEISAG 579
Cdd:TIGR00927  784 QAGEDGEMKgDEGAEGKVEHEGETEAGEKDEHEGQSETQADDTEVKDETGEQELNAENQGEAKQDEKGVDG---GGGSDG 860
                          250       260       270
                   ....*....|....*....|....*....|....
gi 113477011   580 ALTEEKTEADETTEEisagaltEEKTEADETTEE 613
Cdd:TIGR00927  861 GDSEEEEEEEEEEEE-------EEEEEEEEEEEE 887
COG5280 COG5280
Phage-related minor tail protein [Function unknown]
275-604 4.00e-06

Phage-related minor tail protein [Function unknown]


Pssm-ID: 227605 [Multi-domain]  Cd Length: 634  Bit Score: 48.29  E-value: 4.00e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 275 QSRLEHLNKNynihSKSNPDELKKMWEQYQNDYENRLEKVKVKDsldAEKVKTNDLYLSNLDK-ETEADETTEEISAGAL 353
Cdd:COG5280   21 NGAFERVKRE----SNSLGSELKDAGELFKRNISASTEALAQRI---QLLTGQVTLTVKNLDDlAKQQAQVDAQFGSGEI 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 354 TEEKTEADETTEEISAGALTEEKTEADETTEEI--SAGALTEENTEADETteeisAGALTEENTEADETTEEISAGALTE 431
Cdd:COG5280   94 GEEAERLFTREIRVTEGGLTGSLSELNEPTVSVreHGKGLKDEELRFVTG-----GDSSIAEVFESIKDRVTAALGILMK 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 432 -ENTEADETTEEISAGALTEENT--EADETTEEISAgALTEEKTEADETTEEISAGAlteekTEADETTEEISaGALTEE 508
Cdd:COG5280  169 aAGLKGGVATDVIAGGFQAGSAFsgDVDDTLDEYGP-QFGKNGKEAKKLFDTIIDGA-----QKGADSREKVG-DALKEF 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 509 KTEA----DETTEEISAGALTEEKTEADE--TTEEISAGALTEEKTEADETTEEISAGALTEEKTE--ADETTEEISAGA 580
Cdd:COG5280  242 NQQLqdasGAALESLTESALKFSKIMAADgnEAKRAASAAMEALGLSADESQQVLDLVAYVAQNAGdaVDDLADSLAEYS 321
                        330       340       350
                 ....*....|....*....|....*....|
gi 113477011 581 LT--EEKTEADETTEEIS----AGALTEEK 604
Cdd:COG5280  322 STfkDLGLTGGAITALMIkgnkSGALTEDM 351
PTZ00121 PTZ00121
MAEBL; Provisional
262-613 1.02e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 47.44  E-value: 1.02e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  262 KNELNFQDFHSAYQSRLEHLNKNYNIHSKSNPDELKKMWEQYQNDYENRLEKVKVKDSLdaeKVKTNDLYLSNLDKETEA 341
Cdd:PTZ00121 1249 RNNEEIRKFEEARMAHFARRQAAIKAEEARKADELKKAEEKKKADEAKKAEEKKKADEA---KKKAEEAKKADEAKKKAE 1325
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  342 DETTEEISAGALTEEKTEADETTEEISAGAltEEKTEADETTEEISAGALTEENTEADE----TTEEISAGALTEENTEA 417
Cdd:PTZ00121 1326 EAKKKADAAKKKAEEAKKAAEAAKAEAEAA--ADEAEAAEEKAEAAEKKKEEAKKKADAakkkAEEKKKADEAKKKAEED 1403
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  418 DETTEEISAGAltEENTEADETTEEisagalTEENTEADETTEEISAGALTEE-KTEADETTEEISAGALTEEKTEADE- 495
Cdd:PTZ00121 1404 KKKADELKKAA--AAKKKADEAKKK------AEEKKKADEAKKKAEEAKKADEaKKKAEEAKKAEEAKKKAEEAKKADEa 1475
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  496 ---TTEEISAGALTEEKTEADETTEEISAGAltEEKTEADETTEeisagalTEEKTEADETTEeisagalTEEKTEADET 572
Cdd:PTZ00121 1476 kkkAEEAKKADEAKKKAEEAKKKADEAKKAA--EAKKKADEAKK-------AEEAKKADEAKK-------AEEAKKADEA 1539
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|...
gi 113477011  573 TEeisagalTEEKTEADET--TEEISAGaltEEKTEADETTEE 613
Cdd:PTZ00121 1540 KK-------AEEKKKADELkkAEELKKA---EEKKKAEEAKKA 1572
PRK13108 PRK13108
prolipoprotein diacylglyceryl transferase; Reviewed
356-522 1.98e-05

prolipoprotein diacylglyceryl transferase; Reviewed


Pssm-ID: 237284 [Multi-domain]  Cd Length: 460  Bit Score: 46.13  E-value: 1.98e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 356 EKTEADETTEEISAGALTEEKTEADETTEEISAGALTE----ENTEADETTEEISAgalteentEADETTEEISAGALTE 431
Cdd:PRK13108 280 EAPGALRGSEYVVDEALEREPAELAAAAVASAASAVGPvgpgEPNQPDDVAEAVKA--------EVAEVTDEVAAESVVQ 351
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 432 ENTEADETTEEisagalTEENTEADETTEEisAGALTEEKTEADETTEEISAGALTEEKTE--ADETTEEISAGALTEEK 509
Cdd:PRK13108 352 VADRDGESTPA------VEETSEADIEREQ--PGDLAGQAPAAHQVDAEAASAAPEEPAALasEAHDETEPEVPEKAAPI 423
                        170
                 ....*....|...
gi 113477011 510 TEADETTEEISAG 522
Cdd:PRK13108 424 PDPAKPDELAVAG 436
PHA03169 PHA03169
hypothetical protein; Provisional
357-561 9.62e-04

hypothetical protein; Provisional


Pssm-ID: 223003 [Multi-domain]  Cd Length: 413  Bit Score: 40.34  E-value: 9.62e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 357 KTEADETTEEISAGALTEE--KTEADETTEEISAGALTEENTEADETTEEISAGaltEENTEADETTEEISAGALTEENT 434
Cdd:PHA03169  47 APPAPTTSGPQVRAVAEQGhrQTESDTETAEESRHGEKEERGQGGPSGSGSESV---GSPTPSPSGSAEELASGLSPENT 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 435 EadettEEISAGALTEENTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTE-ADETTEEISAGALTEEKTEAD 513
Cdd:PHA03169 124 S-----GSSPESPASHSPPPSPPSHPGPHEPAPPESHNPSPNQQPSSFLQPSHEDSPEePEPPTSEPEPDSPGPPQSETP 198
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 113477011 514 ETTEEISAGAlTEEKTEADETTEEISAGALTEEKTEADETTEEISAGA 561
Cdd:PHA03169 199 TSSPPPQSPP-DEPGEPQSPTPQQAPSPNTQQAVEHEDEPTEPEREGP 245
PLN02847 PLN02847
triacylglycerol lipase
506-617 1.16e-03

triacylglycerol lipase


Pssm-ID: 178439 [Multi-domain]  Cd Length: 633  Bit Score: 40.63  E-value: 1.16e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 506 TEEKTEADETTEEISAGAL-TEEKTEadeTTEEISAGALTEEKTEADETTEEISAgaLTEEKTEADETTEEISAGALTEE 584
Cdd:PLN02847 428 KEDLPEATHVTSSVNSESLvTEVKTT---KSVEHKSESSSSDGSGHDDEEEEEPL--LSEDRVITSSVEEEVTEGELWYE 502
                         90       100       110
                 ....*....|....*....|....*....|....
gi 113477011 585 -KTEADETTEEISAGALTEEKTEADETTEEISAV 617
Cdd:PLN02847 503 lEKELQRQETEVDAQAQEEEAAAAKEITEEENVL 536
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
17-257 4.38e-09

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 56.18  E-value: 4.38e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  17 QGEDFQIA---EDYEQAIVIGVFDGLGGrilgtaketggriasRKVAEITKDILAESQGNLDQDRASEIKGKSCQILKE- 92
Cdd:cd00143   14 TNEDAVVIkpnLNNEDGGLFGVFDGHGG---------------HAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKa 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  93 FADKNlptSRIRGKLASKRLCSTIG---VASLFkrltdeQKYLVQIAWMGDSRIYYLHPHQgLQQLTKDDFKENKNALEV 169
Cdd:cd00143   79 FLRAD---EEILEEAQDEPDDARSGttaVVALI------RGNKLYVANVGDSRAVLCRNGE-AVQLTKDHKPVNEEERER 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 170 IYQ---------------------DLPMSKFLTADPDadweinYKEFEFSEEG-FIFACTDGCFQYLPaPWEFEKLLLKT 227
Cdd:cd00143  149 IEKaggrvsngrvpgvlavtralgDFDLKPGVSAEPD------VTVVKLTEDDdFLILASDGLWDVLS-NQEAVDIVRSE 221
                        250       260       270
                 ....*....|....*....|....*....|
gi 113477011 228 LIESNSMEEWQNLLTNFYKYNKYDDVTLLL 257
Cdd:cd00143  222 LAKEDLQEAAQELVDLALRRGSHDNITVVV 251
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
25-258 4.83e-08

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 53.13  E-value: 4.83e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  25 EDYEQAIVIGVFDGLGGRilgtakeTGGRIASRKVAEITKDilaesqgNLDQDRASEIKGKSCQILKEF---ADKNLptS 101
Cdd:COG0631   33 ENGNLLLLFAVADGMGGH-------AAGEVASKLAVEALAR-------LFDETNFNSLNESLEELLKEAilkANEAI--A 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 102 RIRGKLASKRLCSTIGVASLFKrltdEQKYlvQIAWMGDSRIYYLHPHQgLQQLTKDDfkENKNALEVIYQDLPM----- 176
Cdd:COG0631   97 EEGQLNEDVRGMGTTLVLLLIR----GNKL--YVANVGDSRAYLLRDGE-LKQLTEDH--SLVNRLEQRGIITPEearsh 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 177 ------SKFLTADPDAdwEINYKEFEFSEEGFIFACTDGCFQYLPAPwEFEKLLLKTLIESNSMEEWQNLLTNfykYNKY 250
Cdd:COG0631  168 prrnalTRALGDFDLL--EPDITELELEPGDFLLLCSDGLWDVVSDD-EIVDILKNSETPQEAADKLIELALE---GGGP 241

                 ....*...
gi 113477011 251 DDVTLLLY 258
Cdd:COG0631  242 DNITVVLV 249
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
26-244 7.56e-05

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 43.07  E-value: 7.56e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   26 DYEQAIVIGVFDGLGGRILGtakETGGRIASRKVAEITKDILAESQGNLDQDRASEIKGKSCQILKEFADknlptsriRG 105
Cdd:pfam13672  20 VLSDGWLIAVADGAGSAKYS---DVGARLAVEAAVEALRELLDSGELPELEALVRQILNDILALVRQEAA--------AQ 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  106 KLASKRLCSTIGVAslfkRLTDEQKYLVQIawmGDSRIYYLHPHQGLQQLTKDDFKENKNaleviyqdlpMSKFLT-ADP 184
Cdd:pfam13672  89 GLEPRDYATTLLLA----VITPGGIVFFQI---GDGAIVVRDRDGELQLLSEPDSGEYAN----------ETTFLTsPDA 151
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  185 DADWEInyKEFEFSEEGFIFACTDGCFQYLpAPWEFEKLLLKTLIESNSMEEWQNLLTNF 244
Cdd:pfam13672 152 LEEFRI--RRLTLEPGDALALMTDGLSDSL-VTEEPFFPFFAPLLETLEEEGASEQLAEF 208
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
17-257 2.24e-04

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 41.98  E-value: 2.24e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011    17 QGEDFQIAEDY--EQAIVIGVFDGLGGRIlgtaketggriASRKVAEITKDILAESQGNLDQDRaseikGKSCQILKE-F 93
Cdd:smart00332  22 PMEDAHVITPDlsDSGGFFGVFDGHGGSE-----------AAKFLSKNLPEILAEELIKEKDEL-----EDVEEALRKaF 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011    94 --ADKnlptsRIRGKLASKRLCSTIGVAslfkrLTDEQKYlvqIAWMGDSRIyYLHPHQGLQQLTKDDFKENKNALEVIY 171
Cdd:smart00332  86 lsTDE-----EILEELEALSGSTAVVAL-----ISGNKLY---VANVGDSRA-VLCRNGKAVQLTEDHKPSNEDERARIE 151
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   172 Q---------------------DLPMSKFLTADPDadweinYKEFEFSEEG-FIFACTDGCFQYLPapweFEKL--LLKT 227
Cdd:smart00332 152 AaggfvingrvngvlalsraigDFFLKPYVSAEPD------VTVVELTEKDdFLILASDGLWDVLS----NQEVvdIVRK 221
                          250       260       270
                   ....*....|....*....|....*....|
gi 113477011   228 LIESNSMEEWQNLLTNFYKYNKYDDVTLLL 257
Cdd:smart00332 222 HLSKDPKEAAKRLIDLALARGSKDNITVVV 251
2A1904 TIGR00927
K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying ...
348-613 1.13e-12

K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying compounds].


Pssm-ID: 233191 [Multi-domain]  Cd Length: 1096  Bit Score: 70.02  E-value: 1.13e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   348 ISAGALTEEKTEADETTEEISAGALTEEKTEADETTE-------EISAGALTEENTEADETTEEISAGALTEENTEADET 420
Cdd:TIGR00927  630 LSKGDVAEAEHTGERTGEEGERPTEAEGENGEESGGEaeqegetETKGENESEGEIPAERKGEQEGEGEIEAKEADHKGE 709
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   421 TEEISAGALTEENTEADETTEEISAGALTEEntEADETTEEISAGALTEEKTEADETTEEisagALTEEKTEADETTEEI 500
Cdd:TIGR00927  710 TEAEEVEHEGETEAEGTEDEGEIETGEEGEE--VEDEGEGEAEGKHEVETEGDRKETEHE----GETEAEGKEDEDEGEI 783
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   501 SAGALTEEK-TEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADettEEISAG 579
Cdd:TIGR00927  784 QAGEDGEMKgDEGAEGKVEHEGETEAGEKDEHEGQSETQADDTEVKDETGEQELNAENQGEAKQDEKGVDG---GGGSDG 860
                          250       260       270
                   ....*....|....*....|....*....|....
gi 113477011   580 ALTEEKTEADETTEEisagaltEEKTEADETTEE 613
Cdd:TIGR00927  861 GDSEEEEEEEEEEEE-------EEEEEEEEEEEE 887
2A1904 TIGR00927
K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying ...
403-616 2.14e-07

K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying compounds].


Pssm-ID: 233191 [Multi-domain]  Cd Length: 1096  Bit Score: 52.69  E-value: 2.14e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   403 EEISAGALTEENTEADETTEEIsagaltEENTEADETTEEISAGAlTEENTEADETTEEISAGALTEEKTEADETTEEIS 482
Cdd:TIGR00927  628 GDLSKGDVAEAEHTGERTGEEG------ERPTEAEGENGEESGGE-AEQEGETETKGENESEGEIPAERKGEQEGEGEIE 700
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   483 AgalTEEKTEADETTEEISAGALTEEktEADETTEEISAGALTEEKTEADETteEISAGALTEEKTEADETTEEisagAL 562
Cdd:TIGR00927  701 A---KEADHKGETEAEEVEHEGETEA--EGTEDEGEIETGEEGEEVEDEGEG--EAEGKHEVETEGDRKETEHE----GE 769
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 113477011   563 TEEKTEADETTEEISAGALTEEK-TEADETTEEISAGALTEEKTEADETTEEISA 616
Cdd:TIGR00927  770 TEAEGKEDEDEGEIQAGEDGEMKgDEGAEGKVEHEGETEAGEKDEHEGQSETQAD 824
2A1904 TIGR00927
K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying ...
349-556 8.07e-07

K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying compounds].


Pssm-ID: 233191 [Multi-domain]  Cd Length: 1096  Bit Score: 50.76  E-value: 8.07e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   349 SAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEntEADETTEEISAGALTEenTEADETTEEISAGa 428
Cdd:TIGR00927  695 GEGEIEAKEADHKGETEAEEVEHEGETEAEGTEDEGEIETGEEGEE--VEDEGEGEAEGKHEVE--TEGDRKETEHEGE- 769
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   429 lTEENTEADETTEEISAGALTE-ENTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTE 507
Cdd:TIGR00927  770 -TEAEGKEDEDEGEIQAGEDGEmKGDEGAEGKVEHEGETEAGEKDEHEGQSETQADDTEVKDETGEQELNAENQGEAKQD 848
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|
gi 113477011   508 EK-TEADETTEEISAGALTEEKTEADETTEEisagalTEEKTEADETTEE 556
Cdd:TIGR00927  849 EKgVDGGGGSDGGDSEEEEEEEEEEEEEEEE------EEEEEEEEEENEE 892
COG5280 COG5280
Phage-related minor tail protein [Function unknown]
275-604 4.00e-06

Phage-related minor tail protein [Function unknown]


Pssm-ID: 227605 [Multi-domain]  Cd Length: 634  Bit Score: 48.29  E-value: 4.00e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 275 QSRLEHLNKNynihSKSNPDELKKMWEQYQNDYENRLEKVKVKDsldAEKVKTNDLYLSNLDK-ETEADETTEEISAGAL 353
Cdd:COG5280   21 NGAFERVKRE----SNSLGSELKDAGELFKRNISASTEALAQRI---QLLTGQVTLTVKNLDDlAKQQAQVDAQFGSGEI 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 354 TEEKTEADETTEEISAGALTEEKTEADETTEEI--SAGALTEENTEADETteeisAGALTEENTEADETTEEISAGALTE 431
Cdd:COG5280   94 GEEAERLFTREIRVTEGGLTGSLSELNEPTVSVreHGKGLKDEELRFVTG-----GDSSIAEVFESIKDRVTAALGILMK 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 432 -ENTEADETTEEISAGALTEENT--EADETTEEISAgALTEEKTEADETTEEISAGAlteekTEADETTEEISaGALTEE 508
Cdd:COG5280  169 aAGLKGGVATDVIAGGFQAGSAFsgDVDDTLDEYGP-QFGKNGKEAKKLFDTIIDGA-----QKGADSREKVG-DALKEF 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 509 KTEA----DETTEEISAGALTEEKTEADE--TTEEISAGALTEEKTEADETTEEISAGALTEEKTE--ADETTEEISAGA 580
Cdd:COG5280  242 NQQLqdasGAALESLTESALKFSKIMAADgnEAKRAASAAMEALGLSADESQQVLDLVAYVAQNAGdaVDDLADSLAEYS 321
                        330       340       350
                 ....*....|....*....|....*....|
gi 113477011 581 LT--EEKTEADETTEEIS----AGALTEEK 604
Cdd:COG5280  322 STfkDLGLTGGAITALMIkgnkSGALTEDM 351
PTZ00121 PTZ00121
MAEBL; Provisional
262-613 1.02e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 47.44  E-value: 1.02e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  262 KNELNFQDFHSAYQSRLEHLNKNYNIHSKSNPDELKKMWEQYQNDYENRLEKVKVKDSLdaeKVKTNDLYLSNLDKETEA 341
Cdd:PTZ00121 1249 RNNEEIRKFEEARMAHFARRQAAIKAEEARKADELKKAEEKKKADEAKKAEEKKKADEA---KKKAEEAKKADEAKKKAE 1325
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  342 DETTEEISAGALTEEKTEADETTEEISAGAltEEKTEADETTEEISAGALTEENTEADE----TTEEISAGALTEENTEA 417
Cdd:PTZ00121 1326 EAKKKADAAKKKAEEAKKAAEAAKAEAEAA--ADEAEAAEEKAEAAEKKKEEAKKKADAakkkAEEKKKADEAKKKAEED 1403
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  418 DETTEEISAGAltEENTEADETTEEisagalTEENTEADETTEEISAGALTEE-KTEADETTEEISAGALTEEKTEADE- 495
Cdd:PTZ00121 1404 KKKADELKKAA--AAKKKADEAKKK------AEEKKKADEAKKKAEEAKKADEaKKKAEEAKKAEEAKKKAEEAKKADEa 1475
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  496 ---TTEEISAGALTEEKTEADETTEEISAGAltEEKTEADETTEeisagalTEEKTEADETTEeisagalTEEKTEADET 572
Cdd:PTZ00121 1476 kkkAEEAKKADEAKKKAEEAKKKADEAKKAA--EAKKKADEAKK-------AEEAKKADEAKK-------AEEAKKADEA 1539
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|...
gi 113477011  573 TEeisagalTEEKTEADET--TEEISAGaltEEKTEADETTEE 613
Cdd:PTZ00121 1540 KK-------AEEKKKADELkkAEELKKA---EEKKKAEEAKKA 1572
PTZ00121 PTZ00121
MAEBL; Provisional
294-609 1.51e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 47.06  E-value: 1.51e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  294 DELKKMWEQYQNDYENRLEKVKvKDSLDAEKVKTNDLYLSNLDKETEADETTEEISAGALTEEKTEADETTEeisagalT 373
Cdd:PTZ00121 1215 EEARKAEDAKKAEAVKKAEEAK-KDAEEAKKAEEERNNEEIRKFEEARMAHFARRQAAIKAEEARKADELKK-------A 1286
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  374 EEKTEADETTEEISAGALTEENTEADETTEeisAGALTEENTEADETTEEISAGAltEENTEADETTEEISAGALTEenT 453
Cdd:PTZ00121 1287 EEKKKADEAKKAEEKKKADEAKKKAEEAKK---ADEAKKKAEEAKKKADAAKKKA--EEAKKAAEAAKAEAEAAADE--A 1359
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  454 EADETTEEISAGALTEEKTEADETTEEisagalTEEKTEADETTEEISagaltEEKTEADETTEEisagalTEEKTEADE 533
Cdd:PTZ00121 1360 EAAEEKAEAAEKKKEEAKKKADAAKKK------AEEKKKADEAKKKAE-----EDKKKADELKKA------AAAKKKADE 1422
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 113477011  534 TTEEisagalTEEKTEADETTEEISAGALTEE-KTEADETTEEISAGALTEEKTEADETTEEisagalTEEKTEADE 609
Cdd:PTZ00121 1423 AKKK------AEEKKKADEAKKKAEEAKKADEaKKKAEEAKKAEEAKKKAEEAKKADEAKKK------AEEAKKADE 1487
PRK13108 PRK13108
prolipoprotein diacylglyceryl transferase; Reviewed
356-522 1.98e-05

prolipoprotein diacylglyceryl transferase; Reviewed


Pssm-ID: 237284 [Multi-domain]  Cd Length: 460  Bit Score: 46.13  E-value: 1.98e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 356 EKTEADETTEEISAGALTEEKTEADETTEEISAGALTE----ENTEADETTEEISAgalteentEADETTEEISAGALTE 431
Cdd:PRK13108 280 EAPGALRGSEYVVDEALEREPAELAAAAVASAASAVGPvgpgEPNQPDDVAEAVKA--------EVAEVTDEVAAESVVQ 351
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 432 ENTEADETTEEisagalTEENTEADETTEEisAGALTEEKTEADETTEEISAGALTEEKTE--ADETTEEISAGALTEEK 509
Cdd:PRK13108 352 VADRDGESTPA------VEETSEADIEREQ--PGDLAGQAPAAHQVDAEAASAAPEEPAALasEAHDETEPEVPEKAAPI 423
                        170
                 ....*....|...
gi 113477011 510 TEADETTEEISAG 522
Cdd:PRK13108 424 PDPAKPDELAVAG 436
PRK13108 PRK13108
prolipoprotein diacylglyceryl transferase; Reviewed
432-598 2.36e-05

prolipoprotein diacylglyceryl transferase; Reviewed


Pssm-ID: 237284 [Multi-domain]  Cd Length: 460  Bit Score: 45.74  E-value: 2.36e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 432 ENTEADETTEEISAGALTEENTEADETTEEISAGALTE----EKTEADETTEEISAgalteektEADETTEEISAGALTE 507
Cdd:PRK13108 280 EAPGALRGSEYVVDEALEREPAELAAAAVASAASAVGPvgpgEPNQPDDVAEAVKA--------EVAEVTDEVAAESVVQ 351
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 508 EKTEADETTEEisagalTEEKTEADETTEEisAGALTEEKTEADETTEEISAGALTEEKTE--ADETTEEISAGALTEEK 585
Cdd:PRK13108 352 VADRDGESTPA------VEETSEADIEREQ--PGDLAGQAPAAHQVDAEAASAAPEEPAALasEAHDETEPEVPEKAAPI 423
                        170
                 ....*....|...
gi 113477011 586 TEADETTEEISAG 598
Cdd:PRK13108 424 PDPAKPDELAVAG 436
PRK13108 PRK13108
prolipoprotein diacylglyceryl transferase; Reviewed
375-541 2.85e-05

prolipoprotein diacylglyceryl transferase; Reviewed


Pssm-ID: 237284 [Multi-domain]  Cd Length: 460  Bit Score: 45.35  E-value: 2.85e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 375 EKTEADETTEEISAGALTEENTEADETTEEISAGALTE----ENTEADETTEEISAgalteentEADETTEEISAGALTE 450
Cdd:PRK13108 280 EAPGALRGSEYVVDEALEREPAELAAAAVASAASAVGPvgpgEPNQPDDVAEAVKA--------EVAEVTDEVAAESVVQ 351
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 451 ENTEADETTEEisagalTEEKTEADETTEEisAGALTEEKTEADETTEEISAGALTEEKTE--ADETTEEISAGALTEEK 528
Cdd:PRK13108 352 VADRDGESTPA------VEETSEADIEREQ--PGDLAGQAPAAHQVDAEAASAAPEEPAALasEAHDETEPEVPEKAAPI 423
                        170
                 ....*....|...
gi 113477011 529 TEADETTEEISAG 541
Cdd:PRK13108 424 PDPAKPDELAVAG 436
PRK13108 PRK13108
prolipoprotein diacylglyceryl transferase; Reviewed
394-560 3.03e-05

prolipoprotein diacylglyceryl transferase; Reviewed


Pssm-ID: 237284 [Multi-domain]  Cd Length: 460  Bit Score: 45.35  E-value: 3.03e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 394 ENTEADETTEEISAGALTEENTEADETTEEISAGALTE----ENTEADETTEEISAgalteentEADETTEEISAGALTE 469
Cdd:PRK13108 280 EAPGALRGSEYVVDEALEREPAELAAAAVASAASAVGPvgpgEPNQPDDVAEAVKA--------EVAEVTDEVAAESVVQ 351
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 470 EKTEADETTEEisagalTEEKTEADETTEEisAGALTEEKTEADETTEEISAGALTEEKTE--ADETTEEISAGALTEEK 547
Cdd:PRK13108 352 VADRDGESTPA------VEETSEADIEREQ--PGDLAGQAPAAHQVDAEAASAAPEEPAALasEAHDETEPEVPEKAAPI 423
                        170
                 ....*....|...
gi 113477011 548 TEADETTEEISAG 560
Cdd:PRK13108 424 PDPAKPDELAVAG 436
PRK13108 PRK13108
prolipoprotein diacylglyceryl transferase; Reviewed
413-579 3.03e-05

prolipoprotein diacylglyceryl transferase; Reviewed


Pssm-ID: 237284 [Multi-domain]  Cd Length: 460  Bit Score: 45.35  E-value: 3.03e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 413 ENTEADETTEEISAGALTEENTEADETTEEISAGALTE----ENTEADETTEEISAgalteektEADETTEEISAGALTE 488
Cdd:PRK13108 280 EAPGALRGSEYVVDEALEREPAELAAAAVASAASAVGPvgpgEPNQPDDVAEAVKA--------EVAEVTDEVAAESVVQ 351
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 489 EKTEADETTEEisagalTEEKTEADETTEEisAGALTEEKTEADETTEEISAGALTEEKTE--ADETTEEISAGALTEEK 566
Cdd:PRK13108 352 VADRDGESTPA------VEETSEADIEREQ--PGDLAGQAPAAHQVDAEAASAAPEEPAALasEAHDETEPEVPEKAAPI 423
                        170
                 ....*....|...
gi 113477011 567 TEADETTEEISAG 579
Cdd:PRK13108 424 PDPAKPDELAVAG 436
PRK02224 PRK02224
chromosome segregation protein; Provisional
351-605 3.26e-05

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 45.80  E-value: 3.26e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 351 GALTEEKTEADETTEEISAGALTEEKTEADETTEEISAgalTEENTEADETTEEISAGALTEENTEADETTEEISAGALT 430
Cdd:PRK02224 187 GSLDQLKAQIEEKEEKDLHERLNGLESELAELDEEIER---YEEQREQARETRDEADEVLEEHEERREELETLEAEIEDL 263
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 431 EENTEADETTEEISAGALTEENTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAgALTEEKT 510
Cdd:PRK02224 264 RETIAETEREREELAEEVRDLRERLEELEEERDDLLAEAGLDDADAEAVEARREELEDRDEELRDRLEECRV-AAQAHNE 342
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 511 EADETTEEI----SAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKT 586
Cdd:PRK02224 343 EAESLREDAddleERAEELREEAAELESELEEAREAVEDRREEIEELEEEIEELRERFGDAPVDLGNAEDFLEELREERD 422
                        250
                 ....*....|....*....
gi 113477011 587 EADETTEEISAGALTEEKT 605
Cdd:PRK02224 423 ELREREAELEATLRTARER 441
PTZ00121 PTZ00121
MAEBL; Provisional
290-613 3.89e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 45.52  E-value: 3.89e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  290 KSNPDELKKMWEQYQNDYENRLEKVKVKDSLDAEKVKTNDLYLSNLDKETEADETTEEISAgalTEEKTEADE--TTEEI 367
Cdd:PTZ00121 1301 KKKADEAKKKAEEAKKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEA---AEEKAEAAEkkKEEAK 1377
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  368 SAGALTEEKTEADETTEEISAGAlTEENTEADETTEEISAGALTEE-NTEADETTEEISAGALTEENTEADETTEEISAG 446
Cdd:PTZ00121 1378 KKADAAKKKAEEKKKADEAKKKA-EEDKKKADELKKAAAAKKKADEaKKKAEEKKKADEAKKKAEEAKKADEAKKKAEEA 1456
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  447 ALTEE-NTEADETTEEISAGALTEEKTEADETTEEISagaltEEKTEADETTEEisagalTEEKTEADETTEeisagalT 525
Cdd:PTZ00121 1457 KKAEEaKKKAEEAKKADEAKKKAEEAKKADEAKKKAE-----EAKKKADEAKKA------AEAKKKADEAKK-------A 1518
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  526 EEKTEADETTEeisagalTEEKTEADETTEeisagalTEEKTEADET--TEEISAGaltEEKTEADETTEEISAGALTEE 603
Cdd:PTZ00121 1519 EEAKKADEAKK-------AEEAKKADEAKK-------AEEKKKADELkkAEELKKA---EEKKKAEEAKKAEEDKNMALR 1581
                         330
                  ....*....|
gi 113477011  604 KTEADETTEE 613
Cdd:PTZ00121 1582 KAEEAKKAEE 1591
MDN1 COG5271
AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction ...
329-613 5.03e-05

AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]


Pssm-ID: 227596 [Multi-domain]  Cd Length: 4600  Bit Score: 45.38  E-value: 5.03e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  329 DLYLSNLDKETEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTeeisagalTEENTEADEttEEISAG 408
Cdd:COG5271  4012 DMEAADENKEEADAEKDEPMQDEDPLEENNTLDEDIQQDDFSDLAEDDEKMNEDG--------FEENVQENE--ESTEDG 4081
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  409 ALTEENTEADEtteeisagaltEENTEADETTEEISAGAlTEENTEADETTEEISAGALTEEKTEADETTEEISAGALTE 488
Cdd:COG5271  4082 VKSDEELEQGE-----------VPEDQAIDNHPKMDAKS-TFASAEADEENTDKGIVGENEELGEEDGVRGNGTADGEFE 4149
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  489 EKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTeadetteeisagaLTEEKTEADETTEEISAGALTEEKTE 568
Cdd:COG5271  4150 QVQEDTSTPKEAMSEADRQYQSLGDHLREWQQANRIHEWED-------------LTESQSQAFDDSEFMHVKEDEEEDLQ 4216
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 113477011  569 ADETTEEISAGALTEEKTeADETTEEISAGALTEEktEADETTEE 613
Cdd:COG5271  4217 ALGNAEKDQIKSIDRDES-ANQNPDSMNSTNIAED--EADEVGDK 4258
PRK02224 PRK02224
chromosome segregation protein; Provisional
408-617 6.10e-05

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 44.65  E-value: 6.10e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 408 GALTEENTEADETTEEISAGALTEENTEADETTEEISAgalTEENTEADETTEEISAGALTEEKTEADETTEEISAGALT 487
Cdd:PRK02224 187 GSLDQLKAQIEEKEEKDLHERLNGLESELAELDEEIER---YEEQREQARETRDEADEVLEEHEERREELETLEAEIEDL 263
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 488 EEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAgALTEEKT 567
Cdd:PRK02224 264 RETIAETEREREELAEEVRDLRERLEELEEERDDLLAEAGLDDADAEAVEARREELEDRDEELRDRLEECRV-AAQAHNE 342
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....
gi 113477011 568 EADETTEEI----SAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAV 617
Cdd:PRK02224 343 EAESLREDAddleERAEELREEAAELESELEEAREAVEDRREEIEELEEEIEEL 396
PRK13108 PRK13108
prolipoprotein diacylglyceryl transferase; Reviewed
451-616 7.73e-05

prolipoprotein diacylglyceryl transferase; Reviewed


Pssm-ID: 237284 [Multi-domain]  Cd Length: 460  Bit Score: 44.20  E-value: 7.73e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 451 ENTEADETTEEISAGALTEEKTEADETTEEISAGALTE----EKTEADETTEEISAgalteektEADETTEEISAGALTE 526
Cdd:PRK13108 280 EAPGALRGSEYVVDEALEREPAELAAAAVASAASAVGPvgpgEPNQPDDVAEAVKA--------EVAEVTDEVAAESVVQ 351
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 527 EKTEADETTEEisagalTEEKTEADETTEEisAGALTEEKTEADETTEEISAGALTEEKTE--ADETTEEISAGALTEEK 604
Cdd:PRK13108 352 VADRDGESTPA------VEETSEADIEREQ--PGDLAGQAPAAHQVDAEAASAAPEEPAALasEAHDETEPEVPEKAAPI 423
                        170
                 ....*....|..
gi 113477011 605 TEADETTEEISA 616
Cdd:PRK13108 424 PDPAKPDELAVA 435
TIGR02680 TIGR02680
TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene ...
350-602 1.54e-04

TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length [Hypothetical proteins, Conserved].


Pssm-ID: 233973 [Multi-domain]  Cd Length: 1353  Bit Score: 43.64  E-value: 1.54e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   350 AGALTEEKTEADETTEEISAGALTEEKT-----EADETTEEISAGALTEENTEADETTEEISAGAltEENTEADETTEEI 424
Cdd:TIGR02680  268 ATRLRSAQTQYDQLSRDLGRARDELETAreeerELDARTEALEREADALRTRLEALQGSPAYQDA--EELERARADAEAL 345
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   425 SAGALTEENTEAD-ETTEEISAGALTEENTEADETTEEISagalteekTEADETTEEISAGAL----TEEKTEADETTEE 499
Cdd:TIGR02680  346 QAAAADARQAIREaESRLEEERRRLDEEAGRLDDAERELR--------AAREQLARAAERAGLspahTAEPDAALAAQEL 417
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   500 ISAGALTEEKTEADETTEEISA-GALTEEKTEADETTEEISAGAlTEEKTEADETTEEISAGALTEEKTEADETTEEISA 578
Cdd:TIGR02680  418 QELGALDARRQDADRVIAQRSEqVALLRRRDDVADRAEATHAAA-RARRDELDEEAEQAAARAELADEAVHREGARLAWV 496
                          250       260
                   ....*....|....*....|....
gi 113477011   579 GALTEEKTEADETTEEISAGALTE 602
Cdd:TIGR02680  497 DAWQAQLRELTILAVDDQPGALAD 520
PRK13108 PRK13108
prolipoprotein diacylglyceryl transferase; Reviewed
351-503 1.54e-04

prolipoprotein diacylglyceryl transferase; Reviewed


Pssm-ID: 237284 [Multi-domain]  Cd Length: 460  Bit Score: 43.04  E-value: 1.54e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 351 GALTEEKTEADETTEEISAGALTE----EKTEADETTEEISAgalteentEADETTEEISAGALTEENTEADETTEEisa 426
Cdd:PRK13108 294 EALEREPAELAAAAVASAASAVGPvgpgEPNQPDDVAEAVKA--------EVAEVTDEVAAESVVQVADRDGESTPA--- 362
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 113477011 427 galTEENTEADETTEEisAGALTEENTEADETTEEISAGALTEEKTE--ADETTEEISAGALTEEKTEADETTEEISAG 503
Cdd:PRK13108 363 ---VEETSEADIEREQ--PGDLAGQAPAAHQVDAEAASAAPEEPAALasEAHDETEPEVPEKAAPIPDPAKPDELAVAG 436
PTZ00341 PTZ00341
Ring-infected erythrocyte surface antigen; Provisional
467-612 1.76e-04

Ring-infected erythrocyte surface antigen; Provisional


Pssm-ID: 173534 [Multi-domain]  Cd Length: 1136  Bit Score: 43.24  E-value: 1.76e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  467 LTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEaDETTEEISAGALTEEKTeADETTEEISAGALTEE 546
Cdd:PTZ00341  428 LDGSEDESVEDNEEEHSGDANEEELSVDEHVEEHNADDSGEQQSD-DESGEHQSVNEIVEEQS-VNEHVEEPTVADIVEQ 505
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 113477011  547 KTeADETTEEiSAGALTEEKTEADETTEE--ISAGALTEEKTEADETTEEISAGalTEEKTEADETTE 612
Cdd:PTZ00341  506 ET-VDEHVEE-PAVDENEEQQTADEHVEEptIAEEHVEEEISTAEEHIEEPASD--VQQDSEAAPTIE 569
PTZ00341 PTZ00341
Ring-infected erythrocyte surface antigen; Provisional
454-593 2.01e-04

Ring-infected erythrocyte surface antigen; Provisional


Pssm-ID: 173534 [Multi-domain]  Cd Length: 1136  Bit Score: 43.24  E-value: 2.01e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  454 EADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEaDETTEEISAGALTEEKTeADETTEEISAGALTEEKTeADE 533
Cdd:PTZ00341  434 ESVEDNEEEHSGDANEEELSVDEHVEEHNADDSGEQQSD-DESGEHQSVNEIVEEQS-VNEHVEEPTVADIVEQET-VDE 510
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 113477011  534 TTEEiSAGALTEEKTEADETTEE--ISAGALTEEKTEADETTEEISAGalTEEKTEADETTE 593
Cdd:PTZ00341  511 HVEE-PAVDENEEQQTADEHVEEptIAEEHVEEEISTAEEHIEEPASD--VQQDSEAAPTIE 569
PTZ00341 PTZ00341
Ring-infected erythrocyte surface antigen; Provisional
435-574 2.31e-04

Ring-infected erythrocyte surface antigen; Provisional


Pssm-ID: 173534 [Multi-domain]  Cd Length: 1136  Bit Score: 42.85  E-value: 2.31e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  435 EADETTEEISAGALTEENTEADETTEEISAGALTEEKTEaDETTEEISAGALTEEKTeADETTEEISAGALTEEKTeADE 514
Cdd:PTZ00341  434 ESVEDNEEEHSGDANEEELSVDEHVEEHNADDSGEQQSD-DESGEHQSVNEIVEEQS-VNEHVEEPTVADIVEQET-VDE 510
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 113477011  515 TTEEiSAGALTEEKTEADETTEE--ISAGALTEEKTEADETTEEISAGalTEEKTEADETTE 574
Cdd:PTZ00341  511 HVEE-PAVDENEEQQTADEHVEEptIAEEHVEEEISTAEEHIEEPASD--VQQDSEAAPTIE 569
MDN1 COG5271
AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction ...
392-615 4.13e-04

AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]


Pssm-ID: 227596 [Multi-domain]  Cd Length: 4600  Bit Score: 42.29  E-value: 4.13e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  392 TEENTEADETTEEISAgalteENTEADETTEEISAGALTEENTEADETTEEISAGALTEENTEaDETTEEISAGA----- 466
Cdd:COG5271  3913 EEDLLETEQKSNEQSA-----ANNESDLVSKEDDNKALEDKDRQEKEDEEEMSDDVGIDDEIQ-PDIQENNSQPPpened 3986
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  467 --------LTEEKTEADETT--EEISAGALTEEKTEADETTEEI--SAGALTEEKT-EADETTEEISAGALTEEKTEAD- 532
Cdd:COG5271  3987 ldlpedlkLDEKEGDVSKDSdlEDMDMEAADENKEEADAEKDEPmqDEDPLEENNTlDEDIQQDDFSDLAEDDEKMNEDg 4066
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  533 ------ETTEEISAGALTEEKTEADETTEeiSAGALTEEKTEADETTEEISAGALTEEK---TEADETTEEISAGALTEE 603
Cdd:COG5271  4067 feenvqENEESTEDGVKSDEELEQGEVPE--DQAIDNHPKMDAKSTFASAEADEENTDKgivGENEELGEEDGVRGNGTA 4144
                         250
                  ....*....|..
gi 113477011  604 KTEADETTEEIS 615
Cdd:COG5271  4145 DGEFEQVQEDTS 4156
PRK02224 PRK02224
chromosome segregation protein; Provisional
356-616 9.49e-04

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 40.79  E-value: 9.49e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 356 EKTEADETTEEISAGALTEEKTEADETTEEISAgALTEENTEADETTEEisAGALTEENTEADETTEEISAG------AL 429
Cdd:PRK02224 303 GLDDADAEAVEARREELEDRDEELRDRLEECRV-AAQAHNEEAESLRED--ADDLEERAEELREEAAELESEleeareAV 379
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 430 TEENTEADETTEEISAGALTEENTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKT--EADETTEE-------- 499
Cdd:PRK02224 380 EDRREEIEELEEEIEELRERFGDAPVDLGNAEDFLEELREERDELREREAELEATLRTARERveEAEALLEAgkcpecgq 459
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 500 -ISAGALTEEKTEADETTEEISA--GALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEI 576
Cdd:PRK02224 460 pVEGSPHVETIEEDRERVEELEAelEDLEEEVEEVEERLERAEDLVEAEDRIERLEERREDLEELIAERRETIEEKRERA 539
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 113477011 577 SagALTEEKTEADETTEEISAGAlTEEKTEADETTEEISA 616
Cdd:PRK02224 540 E--ELRERAAELEAEAEEKREAA-AEAEEEAEEAREEVAE 576
PHA03169 PHA03169
hypothetical protein; Provisional
357-561 9.62e-04

hypothetical protein; Provisional


Pssm-ID: 223003 [Multi-domain]  Cd Length: 413  Bit Score: 40.34  E-value: 9.62e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 357 KTEADETTEEISAGALTEE--KTEADETTEEISAGALTEENTEADETTEEISAGaltEENTEADETTEEISAGALTEENT 434
Cdd:PHA03169  47 APPAPTTSGPQVRAVAEQGhrQTESDTETAEESRHGEKEERGQGGPSGSGSESV---GSPTPSPSGSAEELASGLSPENT 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 435 EadettEEISAGALTEENTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTE-ADETTEEISAGALTEEKTEAD 513
Cdd:PHA03169 124 S-----GSSPESPASHSPPPSPPSHPGPHEPAPPESHNPSPNQQPSSFLQPSHEDSPEePEPPTSEPEPDSPGPPQSETP 198
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 113477011 514 ETTEEISAGAlTEEKTEADETTEEISAGALTEEKTEADETTEEISAGA 561
Cdd:PHA03169 199 TSSPPPQSPP-DEPGEPQSPTPQQAPSPNTQQAVEHEDEPTEPEREGP 245
PHA03169 PHA03169
hypothetical protein; Provisional
376-580 1.12e-03

hypothetical protein; Provisional


Pssm-ID: 223003 [Multi-domain]  Cd Length: 413  Bit Score: 40.34  E-value: 1.12e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 376 KTEADETTEEISAGALTEEN--TEADETTEEISAGALTEENTEADETTEEISAGaltEENTEADETTEEISAGALTEENT 453
Cdd:PHA03169  47 APPAPTTSGPQVRAVAEQGHrqTESDTETAEESRHGEKEERGQGGPSGSGSESV---GSPTPSPSGSAEELASGLSPENT 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 454 EadettEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTE-ADETTEEISAGALTEEKTEAD 532
Cdd:PHA03169 124 S-----GSSPESPASHSPPPSPPSHPGPHEPAPPESHNPSPNQQPSSFLQPSHEDSPEePEPPTSEPEPDSPGPPQSETP 198
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 113477011 533 ETTEEISAGAlTEEKTEADETTEEISAGALTEEKTEADETTEEISAGA 580
Cdd:PHA03169 199 TSSPPPQSPP-DEPGEPQSPTPQQAPSPNTQQAVEHEDEPTEPEREGP 245
PLN02847 PLN02847
triacylglycerol lipase
506-617 1.16e-03

triacylglycerol lipase


Pssm-ID: 178439 [Multi-domain]  Cd Length: 633  Bit Score: 40.63  E-value: 1.16e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 506 TEEKTEADETTEEISAGAL-TEEKTEadeTTEEISAGALTEEKTEADETTEEISAgaLTEEKTEADETTEEISAGALTEE 584
Cdd:PLN02847 428 KEDLPEATHVTSSVNSESLvTEVKTT---KSVEHKSESSSSDGSGHDDEEEEEPL--LSEDRVITSSVEEEVTEGELWYE 502
                         90       100       110
                 ....*....|....*....|....*....|....
gi 113477011 585 -KTEADETTEEISAGALTEEKTEADETTEEISAV 617
Cdd:PLN02847 503 lEKELQRQETEVDAQAQEEEAAAAKEITEEENVL 536
PHA03169 PHA03169
hypothetical protein; Provisional
354-542 2.19e-03

hypothetical protein; Provisional


Pssm-ID: 223003 [Multi-domain]  Cd Length: 413  Bit Score: 39.18  E-value: 2.19e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 354 TEEKTEADETTEEISAGALTEEKTEADETTEEISAGaltEENTEADETTEEISAGALTEENTEadETTEEISAGALTEEN 433
Cdd:PHA03169  65 GHRQTESDTETAEESRHGEKEERGQGGPSGSGSESV---GSPTPSPSGSAEELASGLSPENTS--GSSPESPASHSPPPS 139
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 434 TEADEttEEISAGALTEENTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGAlTEEKTEAD 513
Cdd:PHA03169 140 PPSHP--GPHEPAPPESHNPSPNQQPSSFLQPSHEDSPEEPEPPTSEPEPDSPGPPQSETPTSSPPPQSPP-DEPGEPQS 216
                        170       180
                 ....*....|....*....|....*....
gi 113477011 514 ETTEEISAGALTEEKTEADETTEEISAGA 542
Cdd:PHA03169 217 PTPQQAPSPNTQQAVEHEDEPTEPEREGP 245
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
388-609 2.46e-03

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 39.65  E-value: 2.46e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   388 AGALTEENTEADETTEEISAGALTEENTEADETTEEISAGALTEENTEADETTEEISAG-ALTEENTEADETTEEISAGA 466
Cdd:TIGR02168  669 NSSILERRREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQiSALRKDLARLEAEVEQLEER 748
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   467 LTEEKTEADETTEEISAgaLTEEKTEADETTEEISAGaLTEEKTEADETTEEISAG--ALTEEKTEADETTEEISAGALT 544
Cdd:TIGR02168  749 IAQLSKELTELEAEIEE--LEERLEEAEEELAEAEAE-IEELEAQIEQLKEELKALreALDELRAELTLLNEEAANLRER 825
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 113477011   545 EEKTEADETTEEISAGALTEEKTEADETTEEIsAGALTEEKTEADETTEEISAgaLTEEKTEADE 609
Cdd:TIGR02168  826 LESLERRIAATERRLEDLEEQIEELSEDIESL-AAEIEELEELIEELESELEA--LLNERASLEE 887
PHA03169 PHA03169
hypothetical protein; Provisional
373-571 2.50e-03

hypothetical protein; Provisional


Pssm-ID: 223003 [Multi-domain]  Cd Length: 413  Bit Score: 39.18  E-value: 2.50e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 373 TEEKTEADETTEEISAGALTEENTEADE-TTEEISAGALTEENTEADETTEEISAGALTEENTEADETTEEISAGALTEE 451
Cdd:PHA03169  54 SGPQVRAVAEQGHRQTESDTETAEESRHgEKEERGQGGPSGSGSESVGSPTPSPSGSAEELASGLSPENTSGSSPESPAS 133
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 452 NTEADETTEEISAGALTEEKtEADETTEEISAGALTEEKTEADETTEeisaGALTEEKTEADETTEEISAGALTEEKTEA 531
Cdd:PHA03169 134 HSPPPSPPSHPGPHEPAPPE-SHNPSPNQQPSSFLQPSHEDSPEEPE----PPTSEPEPDSPGPPQSETPTSSPPPQSPP 208
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 113477011 532 DETTEEISAGAltEEKTEADETTEEISAGALTEEKTEADE 571
Cdd:PHA03169 209 DEPGEPQSPTP--QQAPSPNTQQAVEHEDEPTEPEREGPP 246
TIGR02680 TIGR02680
TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene ...
407-613 2.91e-03

TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length [Hypothetical proteins, Conserved].


Pssm-ID: 233973 [Multi-domain]  Cd Length: 1353  Bit Score: 39.41  E-value: 2.91e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   407 AGALTEENTEADETTEEISAGA-----LTEENTEADETTEEISAGALTEENTEADETTEEISAGAltEEKTEADETTEEI 481
Cdd:TIGR02680  268 ATRLRSAQTQYDQLSRDLGRARdeletAREEERELDARTEALEREADALRTRLEALQGSPAYQDA--EELERARADAEAL 345
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   482 SAGALTEEKTEAD-ETTEEISAGALTEEKTEADETTEEISagalteekTEADETTEEISAGAL----TEEKTEADETTEE 556
Cdd:TIGR02680  346 QAAAADARQAIREaESRLEEERRRLDEEAGRLDDAERELR--------AAREQLARAAERAGLspahTAEPDAALAAQEL 417
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 113477011   557 ISAGALTEEKTEADETTEEISA-GALTEEKTEADETTEEISAGA------LTEEKTEADETTEE 613
Cdd:TIGR02680  418 QELGALDARRQDADRVIAQRSEqVALLRRRDDVADRAEATHAAArarrdeLDEEAEQAAARAEL 481
nusA PRK09202
transcription elongation factor NusA; Validated
376-509 3.10e-03

transcription elongation factor NusA; Validated


Pssm-ID: 236410 [Multi-domain]  Cd Length: 470  Bit Score: 39.08  E-value: 3.10e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 376 KTEADETTE-EISAGALTEENTEADETTEEIsAGALTEENTEADETTEEISAGALTEENTEADETTEEISAGALTEENTE 454
Cdd:PRK09202 338 MTEEEASEKrQAEFDAILDLFMEALDIDEEI-AQLLVEEGFSSLEELAYVPVEELLEIEGFDEETVEELRERAKEALETE 416
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 113477011 455 ADETTEEISAGALTEEKTEADETTEEISAGALTEEKtEADETTEEISAGALTEEK 509
Cdd:PRK09202 417 ALAQEEKLADDLLSLEGLDRELAFKLAEKGIKTLED-LAEQAVDELIDIEGDEEK 470
PHA03169 PHA03169
hypothetical protein; Provisional
417-613 3.33e-03

hypothetical protein; Provisional


Pssm-ID: 223003 [Multi-domain]  Cd Length: 413  Bit Score: 38.80  E-value: 3.33e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 417 ADETTEEISAGALTEENTEADETTEeisagalTEENTEADETTEEISAGALTEEKTEADE-TTEEISAGALTEEKTEADE 495
Cdd:PHA03169  50 APTTSGPQVRAVAEQGHRQTESDTE-------TAEESRHGEKEERGQGGPSGSGSESVGSpTPSPSGSAEELASGLSPEN 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 496 TTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTE-ADETTEEISAGALTEEKTEADETTE 574
Cdd:PHA03169 123 TSGSSPESPASHSPPPSPPSHPGPHEPAPPESHNPSPNQQPSSFLQPSHEDSPEePEPPTSEPEPDSPGPPQSETPTSSP 202
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 113477011 575 EISAGAlTEEKTEADETTEEISAGALTEEKTEADETTEE 613
Cdd:PHA03169 203 PPQSPP-DEPGEPQSPTPQQAPSPNTQQAVEHEDEPTEP 240
PHA03169 PHA03169
hypothetical protein; Provisional
398-599 3.36e-03

hypothetical protein; Provisional


Pssm-ID: 223003 [Multi-domain]  Cd Length: 413  Bit Score: 38.80  E-value: 3.36e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 398 ADETTEEISAGALTEEN--TEADETTEEISA-GALTEENTEADETTEEISAGALTEENTEADEttEEISAGALTEEKTEA 474
Cdd:PHA03169  50 APTTSGPQVRAVAEQGHrqTESDTETAEESRhGEKEERGQGGPSGSGSESVGSPTPSPSGSAE--ELASGLSPENTSGSS 127
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 475 DETTEEisagaltEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTE-ADETTEEISAGALTEEKTEADET 553
Cdd:PHA03169 128 PESPAS-------HSPPPSPPSHPGPHEPAPPESHNPSPNQQPSSFLQPSHEDSPEePEPPTSEPEPDSPGPPQSETPTS 200
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
gi 113477011 554 TEEISAGAlTEEKTEADETTEEISAGALTEEKTEADETTEEISAGA 599
Cdd:PHA03169 201 SPPPQSPP-DEPGEPQSPTPQQAPSPNTQQAVEHEDEPTEPEREGP 245
nusA PRK09202
transcription elongation factor NusA; Validated
410-547 3.47e-03

transcription elongation factor NusA; Validated


Pssm-ID: 236410 [Multi-domain]  Cd Length: 470  Bit Score: 38.70  E-value: 3.47e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 410 LTEENTEADETTEEisaGALTEENTEADETTEEIsAGALTEENTEADETTEEISAGALTEEKTEADETTEEISAGALTEE 489
Cdd:PRK09202 338 MTEEEASEKRQAEF---DAILDLFMEALDIDEEI-AQLLVEEGFSSLEELAYVPVEELLEIEGFDEETVEELRERAKEAL 413
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 113477011 490 KTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKtEADETTEEISAGALTEEK 547
Cdd:PRK09202 414 ETEALAQEEKLADDLLSLEGLDRELAFKLAEKGIKTLED-LAEQAVDELIDIEGDEEK 470
PTZ00341 PTZ00341
Ring-infected erythrocyte surface antigen; Provisional
393-590 3.95e-03

Ring-infected erythrocyte surface antigen; Provisional


Pssm-ID: 173534 [Multi-domain]  Cd Length: 1136  Bit Score: 39.00  E-value: 3.95e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  393 EENTEAD-ETTEEISAGALTEENTEadETTEEISAGALTEENTEADETTEEISAGALTEENTEadETTEEISAGALTEEK 471
Cdd:PTZ00341  952 EENVEEDaEENVEENVEENVEENVE--ENVEENVEENVEENVEENVEENVEENIEENVEENVE--ENIEENVEEYDEENV 1027
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  472 TEADETTEEISAGALTEEKTEADETTEEisagalteektEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEAD 551
Cdd:PTZ00341 1028 EEVEENVEEYDEENVEEIEENAEENVEE-----------NIEENIEEYDEENVEEIEENIEENIEENVEENVEENVEEIE 1096
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 113477011  552 ETTEE-ISAGALTEEKTEADETTEEISAGALTEEKTEADE 590
Cdd:PTZ00341 1097 ENVEEnVEENAEENAEENAEENAEEYDDENPEEHNEEYDE 1136
PTZ00341 PTZ00341
Ring-infected erythrocyte surface antigen; Provisional
320-479 4.05e-03

Ring-infected erythrocyte surface antigen; Provisional


Pssm-ID: 173534 [Multi-domain]  Cd Length: 1136  Bit Score: 39.00  E-value: 4.05e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  320 LDAEKVKTNDLYLSNLDKETEADETTEEISAgalTEEKTEADETTEEISAGALTEEKTEaDETTEEISAGALTEENTeAD 399
Cdd:PTZ00341  417 FDLEKQKYMDMLDGSEDESVEDNEEEHSGDA---NEEELSVDEHVEEHNADDSGEQQSD-DESGEHQSVNEIVEEQS-VN 491
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  400 ETTEEISAGALTEENTeADETTEEiSAGALTEENTEADETTEE--ISAGALTEENTEADETTEEISAGalTEEKTEADET 477
Cdd:PTZ00341  492 EHVEEPTVADIVEQET-VDEHVEE-PAVDENEEQQTADEHVEEptIAEEHVEEEISTAEEHIEEPASD--VQQDSEAAPT 567

                  ..
gi 113477011  478 TE 479
Cdd:PTZ00341  568 IE 569
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
294-597 4.35e-03

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 38.88  E-value: 4.35e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   294 DELKKMWEQYQNDYENRLEKVK-VKDSLDAEKVKTNDLYLSNLDKETEADETTEEISAGALTEEKTEADETTEEISAGAL 372
Cdd:TIGR02168  680 EELEEKIEELEEKIAELEKALAeLRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTEL 759
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   373 TEEKTEADETTEEISAGA------LTEENTEADETTEEISAG--ALTEENTEADETTEEISAGALTEENTEADETTEEIS 444
Cdd:TIGR02168  760 EAEIEELEERLEEAEEELaeaeaeIEELEAQIEQLKEELKALreALDELRAELTLLNEEAANLRERLESLERRIAATERR 839
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011   445 AGALTEEnteADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEisagaLTEEKTEADETTEEISaGAL 524
Cdd:TIGR02168  840 LEDLEEQ---IEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALAL-----LRSELEELSEELRELE-SKR 910
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 113477011   525 TEEKTEADETTEEISAGALTEEKTEA--DETTEEISAGALTEEktEADETTEEISAGALTEEKTEADETTEEISA 597
Cdd:TIGR02168  911 SELRRELEELREKLAQLELRLEGLEVriDNLQERLSEEYSLTL--EEAEALENKIEDDEEEARRRLKRLENKIKE 983
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
129-158 4.40e-03

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 38.50  E-value: 4.40e-03
                         10        20        30
                 ....*....|....*....|....*....|
gi 113477011 129 QKYLVQIAWMGDSRIYYLHPHQGLQQLTKD 158
Cdd:PRK14559 494 QDTQVAVAHVGDSRLYRVTRKGGLEQLTVD 523
PRK05901 PRK05901
RNA polymerase sigma factor; Provisional
411-610 4.56e-03

RNA polymerase sigma factor; Provisional


Pssm-ID: 235640 [Multi-domain]  Cd Length: 509  Bit Score: 38.44  E-value: 4.56e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 411 TEENTEADETTEEISAGALTEENTEADETTEEISAGALTEENTEADETtEEISAGALTEEKTEADETTEEISAGALTEE- 489
Cdd:PRK05901   5 STKAELAAEEEAKKKLKKLAAKSKSKGFITKEEIKEALESKKKTPEQI-DQVLIFLSGMVKDTDDATESDIPKKKTKTAa 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 490 -KTEADETTEEISAGALTEE-KTEADETTEEI---SAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTE 564
Cdd:PRK05901  84 kAAAAKAPAKKKLKDELDSSkKAEKKNALDKDddlNYVKDIDVLNQADDDDDDDDDDDLDDDDIDDDDDDEDDDEDDDDD 163
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
gi 113477011 565 EKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADET 610
Cdd:PRK05901 164 DVDDEDEEKKEAKELEKLSDDDDFVWDEDDSEALRQARKDAKLTAT 209
PHA03169 PHA03169
hypothetical protein; Provisional
411-609 4.58e-03

hypothetical protein; Provisional


Pssm-ID: 223003 [Multi-domain]  Cd Length: 413  Bit Score: 38.41  E-value: 4.58e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 411 TEENTEADETTEEISAGALTEENTEADE-TTEEISAGALTEENTEADETTEEISAGALTEEKTEADETTEEISAGALTEE 489
Cdd:PHA03169  54 SGPQVRAVAEQGHRQTESDTETAEESRHgEKEERGQGGPSGSGSESVGSPTPSPSGSAEELASGLSPENTSGSSPESPAS 133
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 490 KTEADETTEEISAGALTEEKtEADETTEEISAGALTEEKTEADETTEeisaGALTEEKTEADETTEEISAGALTEEKTEA 569
Cdd:PHA03169 134 HSPPPSPPSHPGPHEPAPPE-SHNPSPNQQPSSFLQPSHEDSPEEPE----PPTSEPEPDSPGPPQSETPTSSPPPQSPP 208
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 113477011 570 DETTEEISAGAltEEKTEADETTEEISAGALTEEKTEADE 609
Cdd:PHA03169 209 DEPGEPQSPTP--QQAPSPNTQQAVEHEDEPTEPEREGPP 246
PHA03169 PHA03169
hypothetical protein; Provisional
392-590 4.79e-03

hypothetical protein; Provisional


Pssm-ID: 223003 [Multi-domain]  Cd Length: 413  Bit Score: 38.41  E-value: 4.79e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 392 TEENTEADETTEEISAGALTEENTEADE-TTEEISAGALTEENTEADETTEEISAGALTEENTEADETTEEISAGALTEE 470
Cdd:PHA03169  54 SGPQVRAVAEQGHRQTESDTETAEESRHgEKEERGQGGPSGSGSESVGSPTPSPSGSAEELASGLSPENTSGSSPESPAS 133
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 471 KTEADETTEEISAGALTEEKtEADETTEEISAGALTEEKTEADETTEeisaGALTEEKTEADETTEEISAGALTEEKTEA 550
Cdd:PHA03169 134 HSPPPSPPSHPGPHEPAPPE-SHNPSPNQQPSSFLQPSHEDSPEEPE----PPTSEPEPDSPGPPQSETPTSSPPPQSPP 208
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 113477011 551 DETTEEISAGAltEEKTEADETTEEISAGALTEEKTEADE 590
Cdd:PHA03169 209 DEPGEPQSPTP--QQAPSPNTQQAVEHEDEPTEPEREGPP 246
PLN02847 PLN02847
triacylglycerol lipase
411-521 5.04e-03

triacylglycerol lipase


Pssm-ID: 178439 [Multi-domain]  Cd Length: 633  Bit Score: 38.32  E-value: 5.04e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 411 TEENTEADETTEEISAGALTEENTEADetTEEISAGALTEENTEADETTEEISAgaLTEEKTEADETTEEISAGALTEE- 489
Cdd:PLN02847 428 KEDLPEATHVTSSVNSESLVTEVKTTK--SVEHKSESSSSDGSGHDDEEEEEPL--LSEDRVITSSVEEEVTEGELWYEl 503
                         90       100       110
                 ....*....|....*....|....*....|..
gi 113477011 490 KTEADETTEEISAGALTEEKTEADETTEEISA 521
Cdd:PLN02847 504 EKELQRQETEVDAQAQEEEAAAAKEITEEENV 535
PRK02224 PRK02224
chromosome segregation protein; Provisional
355-616 5.33e-03

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 38.48  E-value: 5.33e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 355 EEKTEADETTEEISAgalTEEKTEADETTEEISAGALTEENTEADETTEEISAGALTEENTEADETTEEISAGALTEENT 434
Cdd:PRK02224 248 ERREELETLEAEIED---LRETIAETEREREELAEEVRDLRERLEELEEERDDLLAEAGLDDADAEAVEARREELEDRDE 324
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 435 EADETTEEISAgALTEENTEADETTEEisAGALTEEKTEADETTEEISAgALTEEKTEADETTEEISagALTEEKTEADE 514
Cdd:PRK02224 325 ELRDRLEECRV-AAQAHNEEAESLRED--ADDLEERAEELREEAAELES-ELEEAREAVEDRREEIE--ELEEEIEELRE 398
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 515 TTE--EISAGALTEEKTEADETTEEISaGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETT 592
Cdd:PRK02224 399 RFGdaPVDLGNAEDFLEELREERDELR-EREAELEATLRTARERVEEAEALLEAGKCPECGQPVEGSPHVETIEEDRERV 477
                        250       260
                 ....*....|....*....|....
gi 113477011 593 EEisagaLTEEKTEADETTEEISA 616
Cdd:PRK02224 478 EE-----LEAELEDLEEEVEEVEE 496
PRK07735 PRK07735
NADH dehydrogenase subunit C; Validated
448-606 6.18e-03

NADH dehydrogenase subunit C; Validated


Pssm-ID: 236081 [Multi-domain]  Cd Length: 430  Bit Score: 38.04  E-value: 6.18e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 448 LTEENTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEE----ISAGALTEEKTEADETTEEISAGa 523
Cdd:PRK07735  37 LEEENREKEKALPKNDDMTIEEAKRRAAAAAKAKAAALAKQKREGTEEVTEEekakAKAKAAAAAKAKAAALAKQKREG- 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 524 lTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEE 603
Cdd:PRK07735 116 -TEEVTEEEKAAAKAKAAAAAKAKAAALAKQKREGTEEVTEEEEETDKEKAKAKAAAAAKAKAAALAKQKAAEAGEGTEE 194

                 ...
gi 113477011 604 KTE 606
Cdd:PRK07735 195 VTE 197
PLN02847 PLN02847
triacylglycerol lipase
392-502 8.01e-03

triacylglycerol lipase


Pssm-ID: 178439 [Multi-domain]  Cd Length: 633  Bit Score: 37.93  E-value: 8.01e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 392 TEENTEADETTEEISAGALTEENTEADetTEEISAGALTEENTEADETTEEISAgaLTEENTEADETTEEISAGALTEE- 470
Cdd:PLN02847 428 KEDLPEATHVTSSVNSESLVTEVKTTK--SVEHKSESSSSDGSGHDDEEEEEPL--LSEDRVITSSVEEEVTEGELWYEl 503
                         90       100       110
                 ....*....|....*....|....*....|..
gi 113477011 471 KTEADETTEEISAGALTEEKTEADETTEEISA 502
Cdd:PLN02847 504 EKELQRQETEVDAQAQEEEAAAAKEITEEENV 535
SucB_Actino TIGR02927
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; This model ...
349-561 8.29e-03

2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; This model represents an Actinobacterial clade of E2 enzyme, a component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle. These proteins have multiple domains including the catalytic domain (pfam00198), one or two biotin domains (pfam00364) and an E3-component binding domain (pfam02817).


Pssm-ID: 200219 [Multi-domain]  Cd Length: 579  Bit Score: 37.68  E-value: 8.29e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  349 SAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAG--ALTEENTEADETTEEISAGALTEENTEADETTEEISA 426
Cdd:TIGR02927  52 AAGVLLEIRAPEDDTVEVGGVLAIIGEPGEAGSEPAPAAPEpeAAPEPEAPAPAPTPAAEAPAPAAPQAGGSGEATEVKM 131
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  427 GALTEENTEADETTEEISAGalteENTEADETTEEISagalteekteADETTEEI---SAGALTEEKTEADETTEEISAG 503
Cdd:TIGR02927 132 PELGESVTEGTVTSWLKAVG----DTVEVDEPLLEVS----------TDKVDTEIpspVAGTLLEIRAPEDDTVEVGTVL 197
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  504 ALTEEKTEADETTEEISAGALTEEKTE--ADETTEEISAGALTEEKTEADETTEEISAGA 561
Cdd:TIGR02927 198 AIIGDANAAPAEPAEEEAPAPSEAGSEpaPDPAARAPHAAPDPPAPAPAPAKTAAPAAAA 257
PTZ00121 PTZ00121
MAEBL; Provisional
290-616 8.32e-03

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 37.81  E-value: 8.32e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  290 KSNPDELKKMWEQyQNDYENRLEKVKVKDSLDAEKVKTNDLYLSNLDKETEADETTEEISAGALTEEKTEADETTEEISA 369
Cdd:PTZ00121 1443 AKKADEAKKKAEE-AKKAEEAKKKAEEAKKADEAKKKAEEAKKADEAKKKAEEAKKKADEAKKAAEAKKKADEAKKAEEA 1521
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  370 GALTE-EKTEADETTEEISAGaltEENTEADET--TEEISAGALTEENTEADETTEE-ISAGALTEENTEADET-TEEIS 444
Cdd:PTZ00121 1522 KKADEaKKAEEAKKADEAKKA---EEKKKADELkkAEELKKAEEKKKAEEAKKAEEDkNMALRKAEEAKKAEEArIEEVM 1598
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  445 AGALTEENTEADETTEEISAGALTEE--KTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAG 522
Cdd:PTZ00121 1599 KLYEEEKKMKAEEAKKAEEAKIKAEElkKAEEEKKKVEQLKKKEAEEKKKAEELKKAEEENKIKAAEEAKKAEEDKKKAE 1678
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  523 ALteEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTE 602
Cdd:PTZ00121 1679 EA--KKAEEDEKKAAEALKKEAEEAKKAEELKKKEAEEKKKAEELKKAEEENKIKAEEAKKEAEEDKKKAEEAKKDEEEK 1756
                         330
                  ....*....|....
gi 113477011  603 EKTEADETTEEISA 616
Cdd:PTZ00121 1757 KKIAHLKKEEEKKA 1770
nusA PRK09202
transcription elongation factor NusA; Validated
448-585 8.89e-03

transcription elongation factor NusA; Validated


Pssm-ID: 236410 [Multi-domain]  Cd Length: 470  Bit Score: 37.54  E-value: 8.89e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011 448 LTEENTEADETTEEISAGALTEEKTEADEtteeISAGALTEEKTEADETTEEISAGALTEEKTEADETTEEISAGALTEE 527
Cdd:PRK09202 338 MTEEEASEKRQAEFDAILDLFMEALDIDE----EIAQLLVEEGFSSLEELAYVPVEELLEIEGFDEETVEELRERAKEAL 413
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 113477011 528 KTEADETTEEISAGALTEEKTEADETTEEISAGALTEEKtEADETTEEISAGALTEEK 585
Cdd:PRK09202 414 ETEALAQEEKLADDLLSLEGLDRELAFKLAEKGIKTLED-LAEQAVDELIDIEGDEEK 470
MDN1 COG5271
AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction ...
348-616 9.36e-03

AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]


Pssm-ID: 227596 [Multi-domain]  Cd Length: 4600  Bit Score: 37.67  E-value: 9.36e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  348 ISAGALTE--------------EKTEADETTEEISAGALTEEKTEADET----TEEISAGALTEENTEADETTEEisaga 409
Cdd:COG5271  3807 SNSGELESgtglgsgvgaeditNTLNEDDDLEELANEEDTANQSDLDESeareLESDMNGVTKDSVVSENENSDS----- 3881
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  410 lTEENTEADETTEEIS---AGAL---------TEENTEADETTEEISAgalteENTEADETTEEISAGALT--EEKTEAD 475
Cdd:COG5271  3882 -EEENQDLDEEVNDIPedlSNSLneklwdepnEEDLLETEQKSNEQSA-----ANNESDLVSKEDDNKALEdkDRQEKED 3955
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  476 ETTEEISAGALTEEKTEADETTE----EISAGALTE--------EKTEADETTEEISAGALTEEKTEADETTEEI--SAG 541
Cdd:COG5271  3956 EEEMSDDVGIDDEIQPDIQENNSqpppENEDLDLPEdlkldekeGDVSKDSDLEDMDMEAADENKEEADAEKDEPmqDED 4035
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113477011  542 ALTEEKT-EADETTEEISAGALTEEKTEAD-------ETTEEISAGALTEEKTEADETTEeiSAGALTEEKTEADETTEE 613
Cdd:COG5271  4036 PLEENNTlDEDIQQDDFSDLAEDDEKMNEDgfeenvqENEESTEDGVKSDEELEQGEVPE--DQAIDNHPKMDAKSTFAS 4113

                  ...
gi 113477011  614 ISA 616
Cdd:COG5271  4114 AEA 4116
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH