NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|113474474|ref|YP_720535|]
View 

putative protein serine/threonine phosphatase [Trichodesmium erythraeum IMS101]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
467-725 1.07e-54

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 189.07  E-value: 1.07e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 467 SSSKSDVGSQRDHNEDAFGIQTQIESQETsiekiiqakGIYILCDGMGGHAGGEIASHLAVDSIKQYFQTESSWSVGLPs 546
Cdd:cd00143    2 SAGVSDKGGDRKTNEDAVVIKPNLNNEDG---------GLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDI- 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 547 EETIREAVLQANEVIYDLNQqeARSGSGRMGTTLVMAMIYDTEVAVAHVGDSRLYRfSREGGLEQITLDHEVGQR-EVNR 625
Cdd:cd00143   72 EEALRKAFLRADEEILEEAQ--DEPDDARSGTTAVVALIRGNKLYVANVGDSRAVL-CRNGEAVQLTKDHKPVNEeERER 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 626 GV--ELQIAYGR-PDAYQLTQALGPRNENF---VRPDIQFLNLKNDT-LLILASDGLTD---NQLLENNWQTHLkplldK 695
Cdd:cd00143  149 IEkaGGRVSNGRvPGVLAVTRALGDFDLKPgvsAEPDVTVVKLTEDDdFLILASDGLWDvlsNQEAVDIVRSEL-----A 223
                        250       260       270
                 ....*....|....*....|....*....|
gi 113474474 696 QANLELGVSKLIDLANQYNGHDNITAIVIR 725
Cdd:cd00143  224 KEDLQEAAQELVDLALRRGSHDNITVVVVR 253
zinc-ribbons_6 super family cl20081
zinc-ribbons; This family consists of several short, hypothetical bacterial proteins of around ...
2-47 9.55e-05

zinc-ribbons; This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family have 8 highly conserved cysteine residues, which form two zinc ribbon domains.


The actual alignment was detected with superfamily member pfam07191:

Pssm-ID: 148664  Cd Length: 70  Bit Score: 41.13  E-value: 9.55e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 113474474    2 LICPQC--ELENPDNHRYCQKCGVSLT-HKNCHQCGSQvsLKALQ--------CHNC 47
Cdd:pfam07191   2 LICPQCqqELEWKGGHYHCDQCQKDFKkQALCPDCHQE--LEVLKacgavdyfCNHC 56
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
1-733 0e+00

putative protein serine/threonine phosphatase; Provisional


:

Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 942.56  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474   1 MLICPQCELENPDNHRYCQKCGVSLTHKNCHQCGSQVSLKALQCHNCGVYTGQVWKAIIYYQKEVATPSIpeisvnnlsq 80
Cdd:PRK14559   1 MLICPQCQFENPNNNRFCQKCGTSLTHKPCPQCGTEVPVDEAHCPNCGAETGTIWWAIIAQASPNSEVLE---------- 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474  81 qefmtgekpldndslesatkiigeesekilesshnldekiKIEDDYQSNNTFGTSASdieveetqpkaignsdnselttt 160
Cdd:PRK14559  71 ----------------------------------------SGEATQQSESSLTPSSS----------------------- 87
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 161 dilnlvcetvntenqlslndtkilstPSIEKYLDPKQRYQVLET---IPVNNQGQRVVVEVLDRYPLEETPIRAWLK--- 234
Cdd:PRK14559  88 --------------------------PLYGSYLDPGQRYQLLASseeIPTAAAHTELQGRVLDCQPLQPSPLEALLEqle 141
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 235 ----NNSDSFKQITPKAMEALIIPIIAQPYIALQTQIPQNLPTIHDSWRSHSIErlrchskeILLLADYSSWPRLVDLWG 310
Cdd:PRK14559 142 dllnPLADPTEVLPTLLWQQLGIPALAIPYLALQDQFPTEIPKIHDAWQDGDLQ--------VILLEDRSHWQPLLDLWQ 213
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 311 NQQLPQLQILSWLEQMTELWIALMPWDCCQSILEDENLRVNQvdNNYIKLQSLYSK-PGEPKTLEDLMLFWQRLFEQSQR 389
Cdd:PRK14559 214 DQTLPTLQILYWLNQMTQLWKALEPWGCCQSLLELENLRVDE--DQTLGLQQLYQDpPEQPPSLQDLGQVWQQLFTQSQR 291
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 390 TKFGWITALFQDWRNGEIQTIEQLRSYIMNTQDNLQSQAPA---------KSAPTFLQADNSASKIPDdVETQETELLPT 460
Cdd:PRK14559 292 TQFESLIPLLQDLQSGKIQTIAQLRLRLQELATELEAEGEAefestegetTLAPSILQSDDSESPIHE-TEDAPTAVLPM 370
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 461 QLISLESSSKSDVGSQRDHNEDAFGIQTQIESQETSIEKIIQAKGIYILCDGMGGHAGGEIASHLAVDSIKQYFQTesSW 540
Cdd:PRK14559 371 QLVSLEDAGRTDVGRQRHHNEDYFGINTRIQKLENPHGRIVQARGLYILCDGMGGHAAGEVASALAVETLQQYFQQ--HW 448
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 541 SVGLPSEETIREAVLQANEVIYDLNQQEARSGSGRMGTTLVMAMIYDTEVAVAHVGDSRLYRFSREGGLEQITLDHEVGQ 620
Cdd:PRK14559 449 QDELPDEETIREAIYLANEAIYDLNQQNARSGSGRMGTTLVMALVQDTQVAVAHVGDSRLYRVTRKGGLEQLTVDHEVGQ 528
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 621 REVNRGVELQIAYGRPDAYQLTQALGPRNENFVRPDIQFLNLKNDTLLILASDGLTDNQLLENNWQTHLKPLLDKQANLE 700
Cdd:PRK14559 529 REIQRGVEPQIAYARPDAYQLTQALGPRDNSAIQPDIQFLEIEEDTLLLLCSDGLSDNDLLETHWQTHLLPLLSSSANLD 608
                        730       740       750
                 ....*....|....*....|....*....|...
gi 113474474 701 LGVSKLIDLANQYNGHDNITAIVIRALIKPEKD 733
Cdd:PRK14559 609 QGLNKLIDLANQYNGHDNITAILVRLKVRPQLS 641
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
467-725 1.07e-54

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 189.07  E-value: 1.07e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 467 SSSKSDVGSQRDHNEDAFGIQTQIESQETsiekiiqakGIYILCDGMGGHAGGEIASHLAVDSIKQYFQTESSWSVGLPs 546
Cdd:cd00143    2 SAGVSDKGGDRKTNEDAVVIKPNLNNEDG---------GLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDI- 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 547 EETIREAVLQANEVIYDLNQqeARSGSGRMGTTLVMAMIYDTEVAVAHVGDSRLYRfSREGGLEQITLDHEVGQR-EVNR 625
Cdd:cd00143   72 EEALRKAFLRADEEILEEAQ--DEPDDARSGTTAVVALIRGNKLYVANVGDSRAVL-CRNGEAVQLTKDHKPVNEeERER 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 626 GV--ELQIAYGR-PDAYQLTQALGPRNENF---VRPDIQFLNLKNDT-LLILASDGLTD---NQLLENNWQTHLkplldK 695
Cdd:cd00143  149 IEkaGGRVSNGRvPGVLAVTRALGDFDLKPgvsAEPDVTVVKLTEDDdFLILASDGLWDvlsNQEAVDIVRSEL-----A 223
                        250       260       270
                 ....*....|....*....|....*....|
gi 113474474 696 QANLELGVSKLIDLANQYNGHDNITAIVIR 725
Cdd:cd00143  224 KEDLQEAAQELVDLALRRGSHDNITVVVVR 253
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
459-733 2.88e-73

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 240.34  E-value: 2.88e-73
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 459 PTQLISLESSSKSDVGSQRDHNEDAFGIqtqiesqetSIEKIIQAKGIYILCDGMGGHAGGEIASHLAVDSIKQYFQTES 538
Cdd:COG0631    2 SSGILSLKVAGLSDVGTVRKHNEDAFLI---------KPNENGNLLLLFAVADGMGGHAAGEVASKLAVEALARLFDETN 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 539 SWSVGLPSEETIREAVLQANEVIYDLNQqeARSGSGRMGTTLVMAMIYDTEVAVAHVGDSRLYRFsREGGLEQITLDHEV 618
Cdd:COG0631   73 FNSLNESLEELLKEAILKANEAIAEEGQ--LNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLL-RDGELKQLTEDHSL 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 619 GQREVNRGVEL-QIAYGRPDAYQLTQALGPrnENFVRPDIQFLNLKNDTLLILASDGLTDNqlLENNwqtHLKPLLDKQA 697
Cdd:COG0631  150 VNRLEQRGIITpEEARSHPRRNALTRALGD--FDLLEPDITELELEPGDFLLLCSDGLWDV--VSDD---EIVDILKNSE 222
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 113474474 698 NLELGVSKLIDLANQYNGHDNITAIVIRALIKPEKD 733
Cdd:COG0631  223 TPQEAADKLIELALEGGGPDNITVVLVRLNGEGETS 258
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
459-724 9.76e-36

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 135.97  E-value: 9.76e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474   459 PTQLISLESSSKSDVGSQRDHNEDAFGIQTQIESQETsiekiiqakgIYILCDGMGGHAGGEIASHLAVDSIKQYFQTES 538
Cdd:smart00332   2 VSGKNLGLRYGLSSMQGVRKPMEDAHVITPDLSDSGG----------FFGVFDGHGGSEAAKFLSKNLPEILAEELIKEK 71
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474   539 SWSvgLPSEETIREAVLQANEVIYDLNQQearsgsgRMGTTLVMAMIYDTEVAVAHVGDSRLYRFsREGGLEQITLDHEV 618
Cdd:smart00332  72 DEL--EDVEEALRKAFLSTDEEILEELEA-------LSGSTAVVALISGNKLYVANVGDSRAVLC-RNGKAVQLTEDHKP 141
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474   619 G-QREVNRGVELQ--IAYGR-PDAYQLTQALGPR-NENFV--RPDIQFLNL-KNDTLLILASDGLTD---NQLLENNWQT 687
Cdd:smart00332 142 SnEDERARIEAAGgfVINGRvNGVLALSRAIGDFfLKPYVsaEPDVTVVELtEKDDFLILASDGLWDvlsNQEVVDIVRK 221
                          250       260       270
                   ....*....|....*....|....*....|....*..
gi 113474474   688 HLKPLLDKQANlelgvsKLIDLANQYNGHDNITAIVI 724
Cdd:smart00332 222 HLSKDPKEAAK------RLIDLALARGSKDNITVVVV 252
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
468-719 5.67e-17

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 80.48  E-value: 5.67e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474  468 SSKSDVGSQRDHNEDAFGIQTQIESQETSIEKIIQAkgiyiLCDGMGGHAGGEIASHLAVDSIKQYFQTESSWSVglpsE 547
Cdd:pfam00481   3 VGGTRMQGWRKSMEDAHIDGKNLNSSSGKDSWSFFA-----VFDGHGGSEAAKYAGKHLHTILALRRSFLTLRKL----E 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474  548 ETIREAVLQANEVIYDLNQQEARSGSGrmgTTLVMAMIYDTEVAVAHVGDSRLYRFSREGGLEQITLDHE-VGQREVNRG 626
Cdd:pfam00481  74 DALRESFLETDEELRSDAANHEDLSSG---STAVVALIRGNKLYVANVGDSRAVLCRNGGAIKQLTEDHKpSDEDERRRI 150
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474  627 VELQ---IAYGRP-DAYQLTQALG-----PRNENFV-RPDIQFLNL-KNDTLLILASDGLTDnqLLENnwqTHLKPL--- 692
Cdd:pfam00481 151 RAAGgfvSRNGRVnGVLAVSRAFGdfdlkPGEQPVSaEPDITSHKItEDDEFLILACDGLWD--VLSD---QEVVDIvrs 225
                         250       260
                  ....*....|....*....|....*...
gi 113474474  693 -LDKQANLELGVSKLIDLANQYNGHDNI 719
Cdd:pfam00481 226 nLSDGGDPMEAAEKLVDEAIAYGSEDNI 253
zinc-ribbons_6 pfam07191
zinc-ribbons; This family consists of several short, hypothetical bacterial proteins of around ...
2-47 9.55e-05

zinc-ribbons; This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family have 8 highly conserved cysteine residues, which form two zinc ribbon domains.


Pssm-ID: 148664  Cd Length: 70  Bit Score: 41.13  E-value: 9.55e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 113474474    2 LICPQC--ELENPDNHRYCQKCGVSLT-HKNCHQCGSQvsLKALQ--------CHNC 47
Cdd:pfam07191   2 LICPQCqqELEWKGGHYHCDQCQKDFKkQALCPDCHQE--LEVLKacgavdyfCNHC 56
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
1-733 0e+00

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 942.56  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474   1 MLICPQCELENPDNHRYCQKCGVSLTHKNCHQCGSQVSLKALQCHNCGVYTGQVWKAIIYYQKEVATPSIpeisvnnlsq 80
Cdd:PRK14559   1 MLICPQCQFENPNNNRFCQKCGTSLTHKPCPQCGTEVPVDEAHCPNCGAETGTIWWAIIAQASPNSEVLE---------- 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474  81 qefmtgekpldndslesatkiigeesekilesshnldekiKIEDDYQSNNTFGTSASdieveetqpkaignsdnselttt 160
Cdd:PRK14559  71 ----------------------------------------SGEATQQSESSLTPSSS----------------------- 87
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 161 dilnlvcetvntenqlslndtkilstPSIEKYLDPKQRYQVLET---IPVNNQGQRVVVEVLDRYPLEETPIRAWLK--- 234
Cdd:PRK14559  88 --------------------------PLYGSYLDPGQRYQLLASseeIPTAAAHTELQGRVLDCQPLQPSPLEALLEqle 141
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 235 ----NNSDSFKQITPKAMEALIIPIIAQPYIALQTQIPQNLPTIHDSWRSHSIErlrchskeILLLADYSSWPRLVDLWG 310
Cdd:PRK14559 142 dllnPLADPTEVLPTLLWQQLGIPALAIPYLALQDQFPTEIPKIHDAWQDGDLQ--------VILLEDRSHWQPLLDLWQ 213
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 311 NQQLPQLQILSWLEQMTELWIALMPWDCCQSILEDENLRVNQvdNNYIKLQSLYSK-PGEPKTLEDLMLFWQRLFEQSQR 389
Cdd:PRK14559 214 DQTLPTLQILYWLNQMTQLWKALEPWGCCQSLLELENLRVDE--DQTLGLQQLYQDpPEQPPSLQDLGQVWQQLFTQSQR 291
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 390 TKFGWITALFQDWRNGEIQTIEQLRSYIMNTQDNLQSQAPA---------KSAPTFLQADNSASKIPDdVETQETELLPT 460
Cdd:PRK14559 292 TQFESLIPLLQDLQSGKIQTIAQLRLRLQELATELEAEGEAefestegetTLAPSILQSDDSESPIHE-TEDAPTAVLPM 370
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 461 QLISLESSSKSDVGSQRDHNEDAFGIQTQIESQETSIEKIIQAKGIYILCDGMGGHAGGEIASHLAVDSIKQYFQTesSW 540
Cdd:PRK14559 371 QLVSLEDAGRTDVGRQRHHNEDYFGINTRIQKLENPHGRIVQARGLYILCDGMGGHAAGEVASALAVETLQQYFQQ--HW 448
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 541 SVGLPSEETIREAVLQANEVIYDLNQQEARSGSGRMGTTLVMAMIYDTEVAVAHVGDSRLYRFSREGGLEQITLDHEVGQ 620
Cdd:PRK14559 449 QDELPDEETIREAIYLANEAIYDLNQQNARSGSGRMGTTLVMALVQDTQVAVAHVGDSRLYRVTRKGGLEQLTVDHEVGQ 528
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 621 REVNRGVELQIAYGRPDAYQLTQALGPRNENFVRPDIQFLNLKNDTLLILASDGLTDNQLLENNWQTHLKPLLDKQANLE 700
Cdd:PRK14559 529 REIQRGVEPQIAYARPDAYQLTQALGPRDNSAIQPDIQFLEIEEDTLLLLCSDGLSDNDLLETHWQTHLLPLLSSSANLD 608
                        730       740       750
                 ....*....|....*....|....*....|...
gi 113474474 701 LGVSKLIDLANQYNGHDNITAIVIRALIKPEKD 733
Cdd:PRK14559 609 QGLNKLIDLANQYNGHDNITAILVRLKVRPQLS 641
DZR pfam12773
Double zinc ribbon; This family consists of a pair of zinc ribbon domains.
4-48 3.88e-14

Double zinc ribbon; This family consists of a pair of zinc ribbon domains.


Pssm-ID: 257289 [Multi-domain]  Cd Length: 45  Bit Score: 68.22  E-value: 3.88e-14
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
gi 113474474    4 CPQCELENPDNHRYCQKCGVSLTHKNCHQCGSQVSLKALQCHNCG 48
Cdd:pfam12773   1 CPNCGAENPSGAKFCPHCGTSLPPRECPSCGAPVDPNARFCPNCG 45
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
434-724 4.38e-04

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 41.82  E-value: 4.38e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 434 PTFLQADNSASKIPDD--VETQETELLPTqlisLESSSKSDVGSqRDHNEDAFgIQTQIESQETSIEKIIQA-KGIYILC 510
Cdd:PLN03145  36 SSLVKTPASDISVENEltFENMDTEFIPV----VRSGAWADIGS-RSSMEDVY-ICVDNFMSDFGLKNSEDGpSAFYGVF 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 511 DGMGG-HAGGEIASHLAvdsikqYFQTESswsVGLPSE--ETIREAVLQANEVIYDLNQQEARSGSGrmgTTLVMAMIYD 587
Cdd:PLN03145 110 DGHGGkHAADFACYHLP------RFIVED---EDFPREieKVVSSAFLQTDTAFAEACSLDASLASG---TTALAALVVG 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 588 TEVAVAHVGDSRLYrFSREGGLEQITLDHEVGQREVNRGVELQIAYGRpDAY-----QLTQALGPRNENFVR-------- 654
Cdd:PLN03145 178 RSLVVANAGDCRAV-LCRRGKAIEMSRDHKPMCSKERKRIEASGGYVY-DGYlngqlNVARALGDWHMEGMKgsdggpls 255
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 655 --PDIQFLNL-KNDTLLILASDGLTDNQLLEN-------NWQTHLKPLLdkqanlelgVSK-LIDLANQYNGHDNITAIV 723
Cdd:PLN03145 256 aePELMTTQLtEEDEFLIIGCDGIWDVFRSQNavdfarrRLQEHNDPVM---------CSKeLVDEALKRKSGDNLAVVV 326

                 .
gi 113474474 724 I 724
Cdd:PLN03145 327 V 327
PriA COG1198
Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, ...
2-57 1.06e-03

Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]


Pssm-ID: 224119 [Multi-domain]  Cd Length: 730  Bit Score: 41.16  E-value: 1.06e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 113474474   2 LICPQCelenpdNHRY-CQKCGVSLT-HK-----NCHQCGSQvSLKALQCHNCGvytGQVWKA 57
Cdd:COG1198  436 LLCRDC------GYIAeCPNCDSPLTlHKatgqlRCHYCGYQ-EPIPQSCPECG---SEHLRA 488
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
467-725 1.07e-54

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 189.07  E-value: 1.07e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 467 SSSKSDVGSQRDHNEDAFGIQTQIESQETsiekiiqakGIYILCDGMGGHAGGEIASHLAVDSIKQYFQTESSWSVGLPs 546
Cdd:cd00143    2 SAGVSDKGGDRKTNEDAVVIKPNLNNEDG---------GLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDI- 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 547 EETIREAVLQANEVIYDLNQqeARSGSGRMGTTLVMAMIYDTEVAVAHVGDSRLYRfSREGGLEQITLDHEVGQR-EVNR 625
Cdd:cd00143   72 EEALRKAFLRADEEILEEAQ--DEPDDARSGTTAVVALIRGNKLYVANVGDSRAVL-CRNGEAVQLTKDHKPVNEeERER 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 626 GV--ELQIAYGR-PDAYQLTQALGPRNENF---VRPDIQFLNLKNDT-LLILASDGLTD---NQLLENNWQTHLkplldK 695
Cdd:cd00143  149 IEkaGGRVSNGRvPGVLAVTRALGDFDLKPgvsAEPDVTVVKLTEDDdFLILASDGLWDvlsNQEAVDIVRSEL-----A 223
                        250       260       270
                 ....*....|....*....|....*....|
gi 113474474 696 QANLELGVSKLIDLANQYNGHDNITAIVIR 725
Cdd:cd00143  224 KEDLQEAAQELVDLALRRGSHDNITVVVVR 253
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
459-733 2.88e-73

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 240.34  E-value: 2.88e-73
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 459 PTQLISLESSSKSDVGSQRDHNEDAFGIqtqiesqetSIEKIIQAKGIYILCDGMGGHAGGEIASHLAVDSIKQYFQTES 538
Cdd:COG0631    2 SSGILSLKVAGLSDVGTVRKHNEDAFLI---------KPNENGNLLLLFAVADGMGGHAAGEVASKLAVEALARLFDETN 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 539 SWSVGLPSEETIREAVLQANEVIYDLNQqeARSGSGRMGTTLVMAMIYDTEVAVAHVGDSRLYRFsREGGLEQITLDHEV 618
Cdd:COG0631   73 FNSLNESLEELLKEAILKANEAIAEEGQ--LNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLL-RDGELKQLTEDHSL 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 619 GQREVNRGVEL-QIAYGRPDAYQLTQALGPrnENFVRPDIQFLNLKNDTLLILASDGLTDNqlLENNwqtHLKPLLDKQA 697
Cdd:COG0631  150 VNRLEQRGIITpEEARSHPRRNALTRALGD--FDLLEPDITELELEPGDFLLLCSDGLWDV--VSDD---EIVDILKNSE 222
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 113474474 698 NLELGVSKLIDLANQYNGHDNITAIVIRALIKPEKD 733
Cdd:COG0631  223 TPQEAADKLIELALEGGGPDNITVVLVRLNGEGETS 258
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
459-724 9.76e-36

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 135.97  E-value: 9.76e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474   459 PTQLISLESSSKSDVGSQRDHNEDAFGIQTQIESQETsiekiiqakgIYILCDGMGGHAGGEIASHLAVDSIKQYFQTES 538
Cdd:smart00332   2 VSGKNLGLRYGLSSMQGVRKPMEDAHVITPDLSDSGG----------FFGVFDGHGGSEAAKFLSKNLPEILAEELIKEK 71
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474   539 SWSvgLPSEETIREAVLQANEVIYDLNQQearsgsgRMGTTLVMAMIYDTEVAVAHVGDSRLYRFsREGGLEQITLDHEV 618
Cdd:smart00332  72 DEL--EDVEEALRKAFLSTDEEILEELEA-------LSGSTAVVALISGNKLYVANVGDSRAVLC-RNGKAVQLTEDHKP 141
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474   619 G-QREVNRGVELQ--IAYGR-PDAYQLTQALGPR-NENFV--RPDIQFLNL-KNDTLLILASDGLTD---NQLLENNWQT 687
Cdd:smart00332 142 SnEDERARIEAAGgfVINGRvNGVLALSRAIGDFfLKPYVsaEPDVTVVELtEKDDFLILASDGLWDvlsNQEVVDIVRK 221
                          250       260       270
                   ....*....|....*....|....*....|....*..
gi 113474474   688 HLKPLLDKQANlelgvsKLIDLANQYNGHDNITAIVI 724
Cdd:smart00332 222 HLSKDPKEAAK------RLIDLALARGSKDNITVVVV 252
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
471-694 1.31e-19

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 87.79  E-value: 1.31e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474   471 SDVGSQRDHNEDAfgiqTQIESQETSIEKIIQAKGIYILCDGMGGHAGGEIASHLAVDSIKQYfqtesswsvgLPSEETI 550
Cdd:smart00331   1 DDGGLIAQYYEDA----TQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTL----------LSEGISL 66
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474   551 REAVLQANEVIYDLnqqearsGSGRMGTTLVMAMI--YDTEVAVAHVGDSRLYRFSREGGLEQITLDhevgqrevnrgve 628
Cdd:smart00331  67 SQILERLNRAIYEN-------GEDGMFATLFLALYdfAGGTLSYANAGHSPPYLLRADGGLVEDLDD------------- 126
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 113474474   629 lqiaygrpdayqLTQALGPRNEnfVRPDIQFLNLKNDTLLILASDGLTDNQLLEnNWQTHLKPLLD 694
Cdd:smart00331 127 ------------LGAPLGLEPD--VEVDVRELTLEPGDLLLLYTDGLTEARNPE-RLEELLEELLG 177
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
468-719 5.67e-17

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 80.48  E-value: 5.67e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474  468 SSKSDVGSQRDHNEDAFGIQTQIESQETSIEKIIQAkgiyiLCDGMGGHAGGEIASHLAVDSIKQYFQTESSWSVglpsE 547
Cdd:pfam00481   3 VGGTRMQGWRKSMEDAHIDGKNLNSSSGKDSWSFFA-----VFDGHGGSEAAKYAGKHLHTILALRRSFLTLRKL----E 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474  548 ETIREAVLQANEVIYDLNQQEARSGSGrmgTTLVMAMIYDTEVAVAHVGDSRLYRFSREGGLEQITLDHE-VGQREVNRG 626
Cdd:pfam00481  74 DALRESFLETDEELRSDAANHEDLSSG---STAVVALIRGNKLYVANVGDSRAVLCRNGGAIKQLTEDHKpSDEDERRRI 150
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474  627 VELQ---IAYGRP-DAYQLTQALG-----PRNENFV-RPDIQFLNL-KNDTLLILASDGLTDnqLLENnwqTHLKPL--- 692
Cdd:pfam00481 151 RAAGgfvSRNGRVnGVLAVSRAFGdfdlkPGEQPVSaEPDITSHKItEDDEFLILACDGLWD--VLSD---QEVVDIvrs 225
                         250       260
                  ....*....|....*....|....*...
gi 113474474  693 -LDKQANLELGVSKLIDLANQYNGHDNI 719
Cdd:pfam00481 226 nLSDGGDPMEAAEKLVDEAIAYGSEDNI 253
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
480-694 1.36e-11

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 63.48  E-value: 1.36e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474  480 NEDAFGIQtqiesqetsiekiIQAKGIYI-LCDGMGGHAGGEIASHLAVDSIKQYFQTesswSVGLPSEETIREAVLQAN 558
Cdd:pfam13672  12 CQDAFAYR-------------VLSDGWLIaVADGAGSAKYSDVGARLAVEAAVEALRE----LLDSGELPELEALVRQIL 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474  559 EVIYDLNQQEA--RSGSGR-MGTTLVMAMIYDTEVAVAHVGDSRLYRFSREGGLEQITLDHE---VGQrevnrgvelqia 632
Cdd:pfam13672  75 NDILALVRQEAaaQGLEPRdYATTLLLAVITPGGIVFFQIGDGAIVVRDRDGELQLLSEPDSgeyANE------------ 142
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 113474474  633 ygrpdayqlTQALGPRNENFvRPDIQFLNLKNDTLLILASDGLTDNQLLENNWQTHLKPLLD 694
Cdd:pfam13672 143 ---------TTFLTSPDALE-EFRIRRLTLEPGDALALMTDGLSDSLVTEEPFFPFFAPLLE 194
zinc-ribbons_6 pfam07191
zinc-ribbons; This family consists of several short, hypothetical bacterial proteins of around ...
2-47 9.55e-05

zinc-ribbons; This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family have 8 highly conserved cysteine residues, which form two zinc ribbon domains.


Pssm-ID: 148664  Cd Length: 70  Bit Score: 41.13  E-value: 9.55e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 113474474    2 LICPQC--ELENPDNHRYCQKCGVSLT-HKNCHQCGSQvsLKALQ--------CHNC 47
Cdd:pfam07191   2 LICPQCqqELEWKGGHYHCDQCQKDFKkQALCPDCHQE--LEVLKacgavdyfCNHC 56
zinc_ribbon_2 pfam13240
zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as ...
3-25 1.58e-03

zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as in family DZR. pfam12773.


Pssm-ID: 257597  Cd Length: 23  Bit Score: 37.11  E-value: 1.58e-03
                          10        20
                  ....*....|....*....|...
gi 113474474    3 ICPQCELENPDNHRYCQKCGVSL 25
Cdd:pfam13240   1 FCPNCGAELPDGAKFCPNCGAPL 23
zf-ribbon_3 pfam13248
zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as ...
1-25 2.07e-03

zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as in family DZR. pfam12773.


Pssm-ID: 257604  Cd Length: 26  Bit Score: 36.91  E-value: 2.07e-03
                          10        20
                  ....*....|....*....|....*
gi 113474474    1 MLICPQCELENPDNHRYCQKCGVSL 25
Cdd:pfam13248   2 TKFCPNCGAEVPPDAKFCPNCGAKL 26
zf-HYPF pfam07503
HypF finger; The HypF family of proteins are involved in the maturation and regulation of ...
3-39 9.91e-03

HypF finger; The HypF family of proteins are involved in the maturation and regulation of hydrogenase. In the N-terminus they appear to have two Zinc finger domains, as modelled by this family.


Pssm-ID: 254243  Cd Length: 34  Bit Score: 34.71  E-value: 9.91e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 113474474    3 ICPQC--ELENPDNHRYcqkcgvsltHK---NCHQCGSQVSL 39
Cdd:pfam07503   1 LCPEClkEYFDPLNRRF---------HAqfiSCTNCGPRLSL 33
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
1-733 0e+00

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 942.56  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474   1 MLICPQCELENPDNHRYCQKCGVSLTHKNCHQCGSQVSLKALQCHNCGVYTGQVWKAIIYYQKEVATPSIpeisvnnlsq 80
Cdd:PRK14559   1 MLICPQCQFENPNNNRFCQKCGTSLTHKPCPQCGTEVPVDEAHCPNCGAETGTIWWAIIAQASPNSEVLE---------- 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474  81 qefmtgekpldndslesatkiigeesekilesshnldekiKIEDDYQSNNTFGTSASdieveetqpkaignsdnselttt 160
Cdd:PRK14559  71 ----------------------------------------SGEATQQSESSLTPSSS----------------------- 87
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 161 dilnlvcetvntenqlslndtkilstPSIEKYLDPKQRYQVLET---IPVNNQGQRVVVEVLDRYPLEETPIRAWLK--- 234
Cdd:PRK14559  88 --------------------------PLYGSYLDPGQRYQLLASseeIPTAAAHTELQGRVLDCQPLQPSPLEALLEqle 141
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 235 ----NNSDSFKQITPKAMEALIIPIIAQPYIALQTQIPQNLPTIHDSWRSHSIErlrchskeILLLADYSSWPRLVDLWG 310
Cdd:PRK14559 142 dllnPLADPTEVLPTLLWQQLGIPALAIPYLALQDQFPTEIPKIHDAWQDGDLQ--------VILLEDRSHWQPLLDLWQ 213
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 311 NQQLPQLQILSWLEQMTELWIALMPWDCCQSILEDENLRVNQvdNNYIKLQSLYSK-PGEPKTLEDLMLFWQRLFEQSQR 389
Cdd:PRK14559 214 DQTLPTLQILYWLNQMTQLWKALEPWGCCQSLLELENLRVDE--DQTLGLQQLYQDpPEQPPSLQDLGQVWQQLFTQSQR 291
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 390 TKFGWITALFQDWRNGEIQTIEQLRSYIMNTQDNLQSQAPA---------KSAPTFLQADNSASKIPDdVETQETELLPT 460
Cdd:PRK14559 292 TQFESLIPLLQDLQSGKIQTIAQLRLRLQELATELEAEGEAefestegetTLAPSILQSDDSESPIHE-TEDAPTAVLPM 370
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 461 QLISLESSSKSDVGSQRDHNEDAFGIQTQIESQETSIEKIIQAKGIYILCDGMGGHAGGEIASHLAVDSIKQYFQTesSW 540
Cdd:PRK14559 371 QLVSLEDAGRTDVGRQRHHNEDYFGINTRIQKLENPHGRIVQARGLYILCDGMGGHAAGEVASALAVETLQQYFQQ--HW 448
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 541 SVGLPSEETIREAVLQANEVIYDLNQQEARSGSGRMGTTLVMAMIYDTEVAVAHVGDSRLYRFSREGGLEQITLDHEVGQ 620
Cdd:PRK14559 449 QDELPDEETIREAIYLANEAIYDLNQQNARSGSGRMGTTLVMALVQDTQVAVAHVGDSRLYRVTRKGGLEQLTVDHEVGQ 528
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 621 REVNRGVELQIAYGRPDAYQLTQALGPRNENFVRPDIQFLNLKNDTLLILASDGLTDNQLLENNWQTHLKPLLDKQANLE 700
Cdd:PRK14559 529 REIQRGVEPQIAYARPDAYQLTQALGPRDNSAIQPDIQFLEIEEDTLLLLCSDGLSDNDLLETHWQTHLLPLLSSSANLD 608
                        730       740       750
                 ....*....|....*....|....*....|...
gi 113474474 701 LGVSKLIDLANQYNGHDNITAIVIRALIKPEKD 733
Cdd:PRK14559 609 QGLNKLIDLANQYNGHDNITAILVRLKVRPQLS 641
DZR pfam12773
Double zinc ribbon; This family consists of a pair of zinc ribbon domains.
4-48 3.88e-14

Double zinc ribbon; This family consists of a pair of zinc ribbon domains.


Pssm-ID: 257289 [Multi-domain]  Cd Length: 45  Bit Score: 68.22  E-value: 3.88e-14
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
gi 113474474    4 CPQCELENPDNHRYCQKCGVSLTHKNCHQCGSQVSLKALQCHNCG 48
Cdd:pfam12773   1 CPNCGAENPSGAKFCPHCGTSLPPRECPSCGAPVDPNARFCPNCG 45
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
434-724 4.38e-04

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 41.82  E-value: 4.38e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 434 PTFLQADNSASKIPDD--VETQETELLPTqlisLESSSKSDVGSqRDHNEDAFgIQTQIESQETSIEKIIQA-KGIYILC 510
Cdd:PLN03145  36 SSLVKTPASDISVENEltFENMDTEFIPV----VRSGAWADIGS-RSSMEDVY-ICVDNFMSDFGLKNSEDGpSAFYGVF 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 511 DGMGG-HAGGEIASHLAvdsikqYFQTESswsVGLPSE--ETIREAVLQANEVIYDLNQQEARSGSGrmgTTLVMAMIYD 587
Cdd:PLN03145 110 DGHGGkHAADFACYHLP------RFIVED---EDFPREieKVVSSAFLQTDTAFAEACSLDASLASG---TTALAALVVG 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 588 TEVAVAHVGDSRLYrFSREGGLEQITLDHEVGQREVNRGVELQIAYGRpDAY-----QLTQALGPRNENFVR-------- 654
Cdd:PLN03145 178 RSLVVANAGDCRAV-LCRRGKAIEMSRDHKPMCSKERKRIEASGGYVY-DGYlngqlNVARALGDWHMEGMKgsdggpls 255
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113474474 655 --PDIQFLNL-KNDTLLILASDGLTDNQLLEN-------NWQTHLKPLLdkqanlelgVSK-LIDLANQYNGHDNITAIV 723
Cdd:PLN03145 256 aePELMTTQLtEEDEFLIIGCDGIWDVFRSQNavdfarrRLQEHNDPVM---------CSKeLVDEALKRKSGDNLAVVV 326

                 .
gi 113474474 724 I 724
Cdd:PLN03145 327 V 327
PriA COG1198
Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, ...
2-57 1.06e-03

Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]


Pssm-ID: 224119 [Multi-domain]  Cd Length: 730  Bit Score: 41.16  E-value: 1.06e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 113474474   2 LICPQCelenpdNHRY-CQKCGVSLT-HK-----NCHQCGSQvSLKALQCHNCGvytGQVWKA 57
Cdd:COG1198  436 LLCRDC------GYIAeCPNCDSPLTlHKatgqlRCHYCGYQ-EPIPQSCPECG---SEHLRA 488
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH