NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|111226084|ref|YP_716878|]
View 

Serine/threonine specific protein phosphatase [Frankia alni ACN14a]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
1-203 1.97e-49

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 170.20  E-value: 1.97e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084   1 MADGMGGHAAGEVASSMV---ISRLADLDDDIDSDDLVTELNEAVRDANRQLREMSLENSALDGMGTTVTAVLSSGDMLG 77
Cdd:cd00143   35 VFDGHGGHAAGEFASKLLveeLLEELEETLTLSEEDIEEALRKAFLRADEEILEEAQDEPDDARSGTTAVVALIRGNKLY 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084  78 VLHVGDSRAYLLREGILSQVTHDHTLVQdLVDQGRITPE----QANTHPQRSLLMRAL------DGREVEPDLSVRQ-AR 146
Cdd:cd00143  115 VANVGDSRAVLCRNGEAVQLTKDHKPVN-EEERERIEKAggrvSNGRVPGVLAVTRALgdfdlkPGVSAEPDVTVVKlTE 193
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 111226084 147 DGDRYLLCTDGLSGVVSEETILETL----LLPTPQEAVDQLVDLALKGGGPDNITVVVADI 203
Cdd:cd00143  194 DDDFLILASDGLWDVLSNQEAVDIVrselAKEDLQEAAQELVDLALRRGSHDNITVVVVRL 254
BofC_C super family cl07527
BofC C-terminal domain; The C-terminal domain of the bacterial protein 'bypass of ...
319-381 4.34e-03

BofC C-terminal domain; The C-terminal domain of the bacterial protein 'bypass of forespore C' contains a three-stranded beta-sheet and three alpha-helices. Its exact function is, as yet, unknown.


The actual alignment was detected with superfamily member pfam08955:

Pssm-ID: 255125  Cd Length: 75  Bit Score: 35.39  E-value: 4.34e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 111226084  319 YVGVDENGRVALFQGVKGSIAGVHLSSKVShsdrlLSEISPADQDDVRHGIPANSRDEGKQII 381
Cdd:pfam08955  12 YFGISEDGVISIFHGRPEASEIIQSFFQID-----IKKLESHLQAQLEQGIRIRTKDEFEEVI 69
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
1-203 1.97e-49

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 170.20  E-value: 1.97e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084   1 MADGMGGHAAGEVASSMV---ISRLADLDDDIDSDDLVTELNEAVRDANRQLREMSLENSALDGMGTTVTAVLSSGDMLG 77
Cdd:cd00143   35 VFDGHGGHAAGEFASKLLveeLLEELEETLTLSEEDIEEALRKAFLRADEEILEEAQDEPDDARSGTTAVVALIRGNKLY 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084  78 VLHVGDSRAYLLREGILSQVTHDHTLVQdLVDQGRITPE----QANTHPQRSLLMRAL------DGREVEPDLSVRQ-AR 146
Cdd:cd00143  115 VANVGDSRAVLCRNGEAVQLTKDHKPVN-EEERERIEKAggrvSNGRVPGVLAVTRALgdfdlkPGVSAEPDVTVVKlTE 193
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 111226084 147 DGDRYLLCTDGLSGVVSEETILETL----LLPTPQEAVDQLVDLALKGGGPDNITVVVADI 203
Cdd:cd00143  194 DDDFLILASDGLWDVLSNQEAVDIVrselAKEDLQEAAQELVDLALRRGSHDNITVVVVRL 254
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
2-213 9.88e-69

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 221.46  E-value: 9.88e-69
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084   2 ADGMGGHAAGEVASSMVI----SRLADLDDDIDSDDLVTELNEAVRDANRQLREMSLENSALDGMGTTVTAVLSSGDMLG 77
Cdd:COG0631   44 ADGMGGHAAGEVASKLAVealaRLFDETNFNSLNESLEELLKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLY 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084  78 VLHVGDSRAYLLREGILSQVTHDHTLVQDLVDQGRITPEQANTHPQRSLLMRAL-DGREVEPDLSVRQARDGDRYLLCTD 156
Cdd:COG0631  124 VANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEARSHPRRNALTRALgDFDLLEPDITELELEPGDFLLLCSD 203
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 111226084 157 GLSGVVSEETILETLLLP-TPQEAVDQLVDLALKGGGPDNITVVVADISEDHGESRPY 213
Cdd:COG0631  204 GLWDVVSDDEIVDILKNSeTPQEAADKLIELALEGGGPDNITVVLVRLNGEGETSRDY 261
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
2-200 1.73e-29

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 115.16  E-value: 1.73e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084     2 ADGMGGHAAGEVASSMVISRLADLDDDIDSDDLVTElnEAVRDANRQLREMSLENSAlDGMGTTVTAVLSSGDMLGVLHV 81
Cdd:smart00332  43 FDGHGGSEAAKFLSKNLPEILAEELIKEKDELEDVE--EALRKAFLSTDEEILEELE-ALSGSTAVVALISGNKLYVANV 119
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084    82 GDSRAYLLREGILSQVTHDHTlVQDLVDQGRITPEQANTHPQR----SLLMRALDGREV------EPDLSVRQAR-DGDR 150
Cdd:smart00332 120 GDSRAVLCRNGKAVQLTEDHK-PSNEDERARIEAAGGFVINGRvngvLALSRAIGDFFLkpyvsaEPDVTVVELTeKDDF 198
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|...
gi 111226084   151 YLLCTDGLSGVVSEETILETL---LLPTPQEAVDQLVDLALKGGGPDNITVVV 200
Cdd:smart00332 199 LILASDGLWDVLSNQEVVDIVrkhLSKDPKEAAKRLIDLALARGSKDNITVVV 251
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
2-196 2.14e-16

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 77.40  E-value: 2.14e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084    2 ADGMGGHAAGEVASSMVisrlADLDDDIDSDDLVTELNEAVRDANRQLREM---SLENSALDGMGTTVTAVLSSGDMLGV 78
Cdd:pfam00481  40 FDGHGGSEAAKYAGKHL----HTILALRRSFLTLRKLEDALRESFLETDEElrsDAANHEDLSSGSTAVVALIRGNKLYV 115
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084   79 LHVGDSRAYLLREG-ILSQVTHDHTLVQD------------LVDQGRITPEQANThpqRSL----LMRALDGREVEPDLS 141
Cdd:pfam00481 116 ANVGDSRAVLCRNGgAIKQLTEDHKPSDEderrriraaggfVSRNGRVNGVLAVS---RAFgdfdLKPGEQPVSAEPDIT 192
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 111226084  142 VRQARDGDRYL-LCTDGLSGVVSEETILETL-----LLPTPQEAVDQLVDLALKGGGPDNI 196
Cdd:pfam00481 193 SHKITEDDEFLiLACDGLWDVLSDQEVVDIVrsnlsDGGDPMEAAEKLVDEAIAYGSEDNI 253
BofC_C pfam08955
BofC C-terminal domain; The C-terminal domain of the bacterial protein 'bypass of ...
319-381 4.34e-03

BofC C-terminal domain; The C-terminal domain of the bacterial protein 'bypass of forespore C' contains a three-stranded beta-sheet and three alpha-helices. Its exact function is, as yet, unknown.


Pssm-ID: 255125  Cd Length: 75  Bit Score: 35.39  E-value: 4.34e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 111226084  319 YVGVDENGRVALFQGVKGSIAGVHLSSKVShsdrlLSEISPADQDDVRHGIPANSRDEGKQII 381
Cdd:pfam08955  12 YFGISEDGVISIFHGRPEASEIIQSFFQID-----IKKLESHLQAQLEQGIRIRTKDEFEEVI 69
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
3-200 3.72e-28

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 115.92  E-value: 3.72e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084   3 DGMGGHAAGEVASSMVISRLADLDDDIDSDDLVTE--LNEAVRDANRQLREMSLEN--SALDGMGTTVTAVLSSGDMLGV 78
Cdd:PRK14559 421 DGMGGHAAGEVASALAVETLQQYFQQHWQDELPDEetIREAIYLANEAIYDLNQQNarSGSGRMGTTLVMALVQDTQVAV 500
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084  79 LHVGDSRAY-LLREGILSQVTHDHTLVQDLVDQGrITPEQANTHPQRSLLMRALDGRE---VEPDLSVRQARDGDRYLLC 154
Cdd:PRK14559 501 AHVGDSRLYrVTRKGGLEQLTVDHEVGQREIQRG-VEPQIAYARPDAYQLTQALGPRDnsaIQPDIQFLEIEEDTLLLLC 579
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
gi 111226084 155 TDGLSGVVSEETILETLLLP------TPQEAVDQLVDLALKGGGPDNITVVV 200
Cdd:PRK14559 580 SDGLSDNDLLETHWQTHLLPllsssaNLDQGLNKLIDLANQYNGHDNITAIL 631
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
37-200 9.35e-04

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 39.90  E-value: 9.35e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084  37 ELNEAVRDANRQLREMSLENSALDGM---GTTVTAVLSSGDMLGVLHVGDSRAYLLREGILSQVTHDHtlvQDLVDQGRI 113
Cdd:PLN03145 138 EIEKVVSSAFLQTDTAFAEACSLDASlasGTTALAALVVGRSLVVANAGDCRAVLCRRGKAIEMSRDH---KPMCSKERK 214
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084 114 TPEQANTHPQRSLL-----------------MRALDGREV--EPDLSVRQARDGDRYLLC-TDGLSGVVSEETILEtLLL 173
Cdd:PLN03145 215 RIEASGGYVYDGYLngqlnvaralgdwhmegMKGSDGGPLsaEPELMTTQLTEEDEFLIIgCDGIWDVFRSQNAVD-FAR 293
                        170       180       190
                 ....*....|....*....|....*....|...
gi 111226084 174 PTPQEAVD------QLVDLALKGGGPDNITVVV 200
Cdd:PLN03145 294 RRLQEHNDpvmcskELVDEALKRKSGDNLAVVV 326
rad23 TIGR00601
UV excision repair protein Rad23; All proteins in this family for which functions are known ...
375-444 4.29e-03

UV excision repair protein Rad23; All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair].


Pssm-ID: 233045 [Multi-domain]  Cd Length: 378  Bit Score: 37.95  E-value: 4.29e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 111226084  375 DEGKQIIAQLHTPApTRQPVTATPSPSPTNRPKSPSLDPAGLMSAAcqSASPAGAAVPGCPST-PVPTTSP 444
Cdd:TIGR00601  65 KEKDFVVVMVSKPK-TGTGKVAPPAATPTSAPTPTPSPPASPASGM--SAAPASAVEEKSPSEeSATATAP 132
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
1-203 1.97e-49

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 170.20  E-value: 1.97e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084   1 MADGMGGHAAGEVASSMV---ISRLADLDDDIDSDDLVTELNEAVRDANRQLREMSLENSALDGMGTTVTAVLSSGDMLG 77
Cdd:cd00143   35 VFDGHGGHAAGEFASKLLveeLLEELEETLTLSEEDIEEALRKAFLRADEEILEEAQDEPDDARSGTTAVVALIRGNKLY 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084  78 VLHVGDSRAYLLREGILSQVTHDHTLVQdLVDQGRITPE----QANTHPQRSLLMRAL------DGREVEPDLSVRQ-AR 146
Cdd:cd00143  115 VANVGDSRAVLCRNGEAVQLTKDHKPVN-EEERERIEKAggrvSNGRVPGVLAVTRALgdfdlkPGVSAEPDVTVVKlTE 193
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 111226084 147 DGDRYLLCTDGLSGVVSEETILETL----LLPTPQEAVDQLVDLALKGGGPDNITVVVADI 203
Cdd:cd00143  194 DDDFLILASDGLWDVLSNQEAVDIVrselAKEDLQEAAQELVDLALRRGSHDNITVVVVRL 254
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
2-213 9.88e-69

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 221.46  E-value: 9.88e-69
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084   2 ADGMGGHAAGEVASSMVI----SRLADLDDDIDSDDLVTELNEAVRDANRQLREMSLENSALDGMGTTVTAVLSSGDMLG 77
Cdd:COG0631   44 ADGMGGHAAGEVASKLAVealaRLFDETNFNSLNESLEELLKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLY 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084  78 VLHVGDSRAYLLREGILSQVTHDHTLVQDLVDQGRITPEQANTHPQRSLLMRAL-DGREVEPDLSVRQARDGDRYLLCTD 156
Cdd:COG0631  124 VANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEARSHPRRNALTRALgDFDLLEPDITELELEPGDFLLLCSD 203
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 111226084 157 GLSGVVSEETILETLLLP-TPQEAVDQLVDLALKGGGPDNITVVVADISEDHGESRPY 213
Cdd:COG0631  204 GLWDVVSDDEIVDILKNSeTPQEAADKLIELALEGGGPDNITVVLVRLNGEGETSRDY 261
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
2-200 1.73e-29

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 115.16  E-value: 1.73e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084     2 ADGMGGHAAGEVASSMVISRLADLDDDIDSDDLVTElnEAVRDANRQLREMSLENSAlDGMGTTVTAVLSSGDMLGVLHV 81
Cdd:smart00332  43 FDGHGGSEAAKFLSKNLPEILAEELIKEKDELEDVE--EALRKAFLSTDEEILEELE-ALSGSTAVVALISGNKLYVANV 119
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084    82 GDSRAYLLREGILSQVTHDHTlVQDLVDQGRITPEQANTHPQR----SLLMRALDGREV------EPDLSVRQAR-DGDR 150
Cdd:smart00332 120 GDSRAVLCRNGKAVQLTEDHK-PSNEDERARIEAAGGFVINGRvngvLALSRAIGDFFLkpyvsaEPDVTVVELTeKDDF 198
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|...
gi 111226084   151 YLLCTDGLSGVVSEETILETL---LLPTPQEAVDQLVDLALKGGGPDNITVVV 200
Cdd:smart00332 199 LILASDGLWDVLSNQEVVDIVrkhLSKDPKEAAKRLIDLALARGSKDNITVVV 251
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
2-196 2.14e-16

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 77.40  E-value: 2.14e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084    2 ADGMGGHAAGEVASSMVisrlADLDDDIDSDDLVTELNEAVRDANRQLREM---SLENSALDGMGTTVTAVLSSGDMLGV 78
Cdd:pfam00481  40 FDGHGGSEAAKYAGKHL----HTILALRRSFLTLRKLEDALRESFLETDEElrsDAANHEDLSSGSTAVVALIRGNKLYV 115
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084   79 LHVGDSRAYLLREG-ILSQVTHDHTLVQD------------LVDQGRITPEQANThpqRSL----LMRALDGREVEPDLS 141
Cdd:pfam00481 116 ANVGDSRAVLCRNGgAIKQLTEDHKPSDEderrriraaggfVSRNGRVNGVLAVS---RAFgdfdLKPGEQPVSAEPDIT 192
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 111226084  142 VRQARDGDRYL-LCTDGLSGVVSEETILETL-----LLPTPQEAVDQLVDLALKGGGPDNI 196
Cdd:pfam00481 193 SHKITEDDEFLiLACDGLWDVLSDQEVVDIVrsnlsDGGDPMEAAEKLVDEAIAYGSEDNI 253
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
2-188 1.41e-14

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 71.23  E-value: 1.41e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084     2 ADGMGGHAAGEVASSMVISrladldDDIDSDDLVTELNEAVRDANRQLREMslensALDGMGTTVTAVLS--SGDMLGVL 79
Cdd:smart00331  36 ADVMGKGLAAALAMSMARS------ALRTLLSEGISLSQILERLNRAIYEN-----GEDGMFATLFLALYdfAGGTLSYA 104
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084    80 HVGDSRAYLLREgilsqvthDHTLVQDLVDQGRITpeqanthpqrsllmraldGREVEPDLSVR--QARDGDRYLLCTDG 157
Cdd:smart00331 105 NAGHSPPYLLRA--------DGGLVEDLDDLGAPL------------------GLEPDVEVDVRelTLEPGDLLLLYTDG 158
                          170       180       190
                   ....*....|....*....|....*....|....
gi 111226084   158 LSGVVSEE---TILETLLLPTPQEAVDQLVDLAL 188
Cdd:smart00331 159 LTEARNPErleELLEELLGSPPAEIAQRILEELL 192
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
1-186 2.96e-11

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 61.56  E-value: 2.96e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084    1 MADGMGGHAAGEVASSMVISRLADLDDDIDSDDLVTELNEAVRDANRQLREMSLENSALDGM-----GTTVTAVLSSGDM 75
Cdd:pfam13672  29 VADGAGSAKYSDVGARLAVEAAVEALRELLDSGELPELEALVRQILNDILALVRQEAAAQGLeprdyATTLLLAVITPGG 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084   76 LGVLHVGDSR-AYLLREGILSQVTHDHTLvqdlvdqgritpEQANThpqrsllMRALDGREVEPDLSVRQ--ARDGDRYL 152
Cdd:pfam13672 109 IVFFQIGDGAiVVRDRDGELQLLSEPDSG------------EYANE-------TTFLTSPDALEEFRIRRltLEPGDALA 169
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 111226084  153 LCTDGLSGVVSEETILETLL-----LPTPQEAVDQLVDL 186
Cdd:pfam13672 170 LMTDGLSDSLVTEEPFFPFFaplleTLEEEGASEQLAEF 208
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
60-203 3.64e-03

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 37.27  E-value: 3.64e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084   60 DGMGTTVTAVLSSGDMLGVLhvgdsRAYLLREGILSQV-THDHTLVQDLVDQGR--------ITPEQANT------HPqR 124
Cdd:pfam07228  11 DVMGHGLPAALLMGMLRTAL-----RALALEGLDPAEVlERLNRALQRNLEGERfatavlavYDPETGTLeyanagHP-P 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084  125 SLLMRALDGRE-----------VEPDLSVRQAR----DGDRYLLCTDGLS----------GVVSEETILETLLLPTPQEA 179
Cdd:pfam07228  85 PLLLRPDGGVVellespglplgVLPDAPYETAEfplePGDTLLLYTDGLTeardpdgelfGLERLLALLAERHGLSPEEL 164
                         170       180
                  ....*....|....*....|....*..
gi 111226084  180 VDQLVDLALKGGGP---DNITVVVADI 203
Cdd:pfam07228 165 LDALLEDLLRLGGGeleDDITLLVLRV 191
BofC_C pfam08955
BofC C-terminal domain; The C-terminal domain of the bacterial protein 'bypass of ...
319-381 4.34e-03

BofC C-terminal domain; The C-terminal domain of the bacterial protein 'bypass of forespore C' contains a three-stranded beta-sheet and three alpha-helices. Its exact function is, as yet, unknown.


Pssm-ID: 255125  Cd Length: 75  Bit Score: 35.39  E-value: 4.34e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 111226084  319 YVGVDENGRVALFQGVKGSIAGVHLSSKVShsdrlLSEISPADQDDVRHGIPANSRDEGKQII 381
Cdd:pfam08955  12 YFGISEDGVISIFHGRPEASEIIQSFFQID-----IKKLESHLQAQLEQGIRIRTKDEFEEVI 69
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
3-200 3.72e-28

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 115.92  E-value: 3.72e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084   3 DGMGGHAAGEVASSMVISRLADLDDDIDSDDLVTE--LNEAVRDANRQLREMSLEN--SALDGMGTTVTAVLSSGDMLGV 78
Cdd:PRK14559 421 DGMGGHAAGEVASALAVETLQQYFQQHWQDELPDEetIREAIYLANEAIYDLNQQNarSGSGRMGTTLVMALVQDTQVAV 500
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084  79 LHVGDSRAY-LLREGILSQVTHDHTLVQDLVDQGrITPEQANTHPQRSLLMRALDGRE---VEPDLSVRQARDGDRYLLC 154
Cdd:PRK14559 501 AHVGDSRLYrVTRKGGLEQLTVDHEVGQREIQRG-VEPQIAYARPDAYQLTQALGPRDnsaIQPDIQFLEIEEDTLLLLC 579
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
gi 111226084 155 TDGLSGVVSEETILETLLLP------TPQEAVDQLVDLALKGGGPDNITVVV 200
Cdd:PRK14559 580 SDGLSDNDLLETHWQTHLLPllsssaNLDQGLNKLIDLANQYNGHDNITAIL 631
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
37-200 9.35e-04

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 39.90  E-value: 9.35e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084  37 ELNEAVRDANRQLREMSLENSALDGM---GTTVTAVLSSGDMLGVLHVGDSRAYLLREGILSQVTHDHtlvQDLVDQGRI 113
Cdd:PLN03145 138 EIEKVVSSAFLQTDTAFAEACSLDASlasGTTALAALVVGRSLVVANAGDCRAVLCRRGKAIEMSRDH---KPMCSKERK 214
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084 114 TPEQANTHPQRSLL-----------------MRALDGREV--EPDLSVRQARDGDRYLLC-TDGLSGVVSEETILEtLLL 173
Cdd:PLN03145 215 RIEASGGYVYDGYLngqlnvaralgdwhmegMKGSDGGPLsaEPELMTTQLTEEDEFLIIgCDGIWDVFRSQNAVD-FAR 293
                        170       180       190
                 ....*....|....*....|....*....|...
gi 111226084 174 PTPQEAVD------QLVDLALKGGGPDNITVVV 200
Cdd:PLN03145 294 RRLQEHNDpvmcskELVDEALKRKSGDNLAVVV 326
tatB PRK00404
sec-independent translocase; Provisional
375-444 1.20e-03

sec-independent translocase; Provisional


Pssm-ID: 166942 [Multi-domain]  Cd Length: 141  Bit Score: 37.89  E-value: 1.20e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111226084 375 DEGKQIIAQLHTPAPTrQPVTATPSPSPTNRPKSPSLDPAGLMSAACQSASPAGAAVPGCPSTPVPTTSP 444
Cdd:PRK00404  73 QEARKILAPLTPPAPP-EPVTPPTAQSPAPAVPTPPPTSTPAVPPAPAAAVPAPAAAPPPSDPPQPPRAP 141
rad23 TIGR00601
UV excision repair protein Rad23; All proteins in this family for which functions are known ...
375-444 4.29e-03

UV excision repair protein Rad23; All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair].


Pssm-ID: 233045 [Multi-domain]  Cd Length: 378  Bit Score: 37.95  E-value: 4.29e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 111226084  375 DEGKQIIAQLHTPApTRQPVTATPSPSPTNRPKSPSLDPAGLMSAAcqSASPAGAAVPGCPST-PVPTTSP 444
Cdd:TIGR00601  65 KEKDFVVVMVSKPK-TGTGKVAPPAATPTSAPTPTPSPPASPASGM--SAAPASAVEEKSPSEeSATATAP 132
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH