NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|111220137|ref|YP_710931|]
View 

sensory transduction histidine kinase [Frankia alni ACN14a]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
14-127 1.68e-09

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


:

Pssm-ID: 238088  Cd Length: 113  Bit Score: 54.50  E-value: 1.68e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  14 LLVEDDDADAYLVSELLDEvaAPVELTRVRTVAEAVRR--SKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTGL 91
Cdd:cd00156    1 LIVDDDPLIRELLRRLLEK--EGYEVVEAEDGEEALALlaEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAH 78
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 111220137  92 VDEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVRYAI 127
Cdd:cd00156   79 GDDEDAVEALKAGADDYLTK-PFSPEELLARIRALL 113
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
193-383 1.60e-32

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 121.63  E-value: 1.60e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  193 PDGTIHVLLGDVCGHGPDEAALGVSLRIAWRTLVLAGVAEADRLGYLQRVLVSERErDEIFATVCALSIAPDRASLRMRL 272
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLE-GERFATAVLAVYDPETGTLEYAN 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  273 AGHPPPALLHP-RLAALPGDVVGPALGILDEDLTEEVLVELGPRWVLLLATDGLLEGREgPGGEPLGWEGVLpEIAQLWP 351
Cdd:pfam07228  80 AGHPPPLLLRPdGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARD-PDGELFGLERLL-ALLAERH 157
                         170       180       190
                  ....*....|....*....|....*....|..
gi 111220137  352 PDGPDGLLDSLIDRVEARNGGPLTDDVALLLL 383
Cdd:pfam07228 158 GLSPEELLDALLEDLLRLGGGELEDDITLLVL 189
OmpR COG0745
Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding ...
13-151 4.53e-08

Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]


:

Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 51.91  E-value: 4.53e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDDADAYLVSELLDEvaAPVELTRVRTVAEAVRR-SKQVSCVLLDLGLPDSEGLSALRRLLAVEA-GAPVVVLTG 90
Cdd:COG0745    3 ILLVEDDPELAELLKEYLEE--EGYEVDVAADGEEALEAaREQPDLVLLDLMLPDLDGLELCRRLRAKKGsGPPIIVLTA 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 111220137  91 LVDEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVRYAIERKR---ADTAAQALRESELRADERAR 151
Cdd:COG0745   81 RDDEEDRVLGLEAGADDYLTK-PFSPRELLARLRALLRRNAgasRAEASEVLVFGDLTLDPDTR 143
 
Name Accession Description Interval E-value
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
14-127 1.68e-09

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 54.50  E-value: 1.68e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  14 LLVEDDDADAYLVSELLDEvaAPVELTRVRTVAEAVRR--SKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTGL 91
Cdd:cd00156    1 LIVDDDPLIRELLRRLLEK--EGYEVVEAEDGEEALALlaEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAH 78
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 111220137  92 VDEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVRYAI 127
Cdd:cd00156   79 GDDEDAVEALKAGADDYLTK-PFSPEELLARIRALL 113
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
193-383 1.60e-32

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 121.63  E-value: 1.60e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  193 PDGTIHVLLGDVCGHGPDEAALGVSLRIAWRTLVLAGVAEADRLGYLQRVLVSERErDEIFATVCALSIAPDRASLRMRL 272
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLE-GERFATAVLAVYDPETGTLEYAN 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  273 AGHPPPALLHP-RLAALPGDVVGPALGILDEDLTEEVLVELGPRWVLLLATDGLLEGREgPGGEPLGWEGVLpEIAQLWP 351
Cdd:pfam07228  80 AGHPPPLLLRPdGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARD-PDGELFGLERLL-ALLAERH 157
                         170       180       190
                  ....*....|....*....|....*....|..
gi 111220137  352 PDGPDGLLDSLIDRVEARNGGPLTDDVALLLL 383
Cdd:pfam07228 158 GLSPEELLDALLEDLLRLGGGELEDDITLLVL 189
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
164-337 4.37e-19

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 83.55  E-value: 4.37e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137   164 DRQLLHAARYRPGRQqslLGGDFYDMVSTPDGTIHVLLGDVCGHGPDEAALGVSLRIAWRTLVLAGVAEADRLGYLQRVl 243
Cdd:smart00331   1 DDGGLIAQYYEDATQ---VGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRA- 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137   244 VSERERDEIFATVCALSIAPDRASLRMRLAGHPPPALLHP-RLAALPGDVVGPALGILDEDLTEEVLVELGPRWVLLLAT 322
Cdd:smart00331  77 IYENGEDGMFATLFLALYDFAGGTLSYANAGHSPPYLLRAdGGLVEDLDDLGAPLGLEPDVEVDVRELTLEPGDLLLLYT 156
                          170
                   ....*....|....*
gi 111220137   323 DGLLEGREGPGGEPL 337
Cdd:smart00331 157 DGLTEARNPERLEEL 171
CheY COG0784
FOG: CheY-like receiver [Signal transduction mechanisms]
13-133 5.58e-14

FOG: CheY-like receiver [Signal transduction mechanisms]


Pssm-ID: 223855  Cd Length: 130  Bit Score: 67.95  E-value: 5.58e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDDADAYLVSELLDEVAAPVELTRVRTVA--EAVRRSKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTG 90
Cdd:COG0784    8 VLVVDDEPVNRRLLKRLLEDLGYEVVEAADGEEEalELLRELPQPDLILLDINMPGMDGIELLRRLRARGPNIPVILLTA 87
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 111220137  91 LVDEYRGAQAVAAGAQDYLVKGQVDGRDLVRAVRYAIERKRAD 133
Cdd:COG0784   88 YADEADRERALAAGADDYLTKPIFLEEELLAALRRLLARAAAE 130
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
13-124 2.59e-07

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 249561  Cd Length: 111  Bit Score: 47.95  E-value: 2.59e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137   13 ILLVEDDDADAYLVSELLDEVAAPVELTRVRTVAEAVRRSKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTGLV 92
Cdd:pfam00072   1 VLIVDDDPLIRELLRQLLEKEGYVVAEADDGEEALELLKEKRPDLILLDIRMPGMDGLELLRRIRRRPPTTPVIVLTAHG 80
                          90       100       110
                  ....*....|....*....|....*....|..
gi 111220137   93 DEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVR 124
Cdd:pfam00072  81 DEEDAVEALKAGANDFLSK-PFDPEELLAALR 111
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
119-383 7.80e-17

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 79.75  E-value: 7.80e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137 119 LVRAVRYAIERKRADTAAQALRESELraDERARLERGLLPRPLYDDRQLLHAARYRPGRQqslLGGDFYDMVSTPDGTIH 198
Cdd:COG2208  103 INRAVGLVSAHNELLLLEQNNISAEL--EVARQIQQNLLPKALPLFPGIDIEAILVPASE---VGGDYYDFIQLGEKRLR 177
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137 199 VLLGDVCGHGPDEAALGVSLRIAWRTLVLAGVAE-ADRLGYLQRVLVSERERDeIFATVCALSIAPDRASLRMRLAGHPP 277
Cdd:COG2208  178 IGIGDVSGKGVPAALLMLMPKLALRLLLESGPLDpADVLETLNRVLKQNLEED-MFVTLFLGVYDLDSGELTYSNAGHEP 256
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137 278 PALLHPRLAALPGDVV--GPALGILDEDLTEEVLVELGPRWVLLLATDGLLEGReGPGGEPLGWEGvLPEIAQLWPPDGP 355
Cdd:COG2208  257 ALILSADGEIEVEDLTalGLPIGLLPDYQYEVASLQLEPGDLLVLYTDGVTEAR-NSDGEFFGLER-LLKILGRLLGQPA 334
                        250       260
                 ....*....|....*....|....*....
gi 111220137 356 DGLLDSLIDRVEARNGG-PLTDDVALLLL 383
Cdd:COG2208  335 EEILEAILESLEELQGDqIQDDDITLLVL 363
OmpR COG0745
Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding ...
13-151 4.53e-08

Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]


Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 51.91  E-value: 4.53e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDDADAYLVSELLDEvaAPVELTRVRTVAEAVRR-SKQVSCVLLDLGLPDSEGLSALRRLLAVEA-GAPVVVLTG 90
Cdd:COG0745    3 ILLVEDDPELAELLKEYLEE--EGYEVDVAADGEEALEAaREQPDLVLLDLMLPDLDGLELCRRLRAKKGsGPPIIVLTA 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 111220137  91 LVDEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVRYAIERKR---ADTAAQALRESELRADERAR 151
Cdd:COG0745   81 RDDEEDRVLGLEAGADDYLTK-PFSPRELLARLRALLRRNAgasRAEASEVLVFGDLTLDPDTR 143
PRK10643 PRK10643
DNA-binding transcriptional regulator BasR; Provisional
13-89 3.42e-05

DNA-binding transcriptional regulator BasR; Provisional


Pssm-ID: 182612 [Multi-domain]  Cd Length: 222  Bit Score: 43.49  E-value: 3.42e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDdadaylvsELLDE---VAAPVE---LTRVRTVAEAVR--RSKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAP 84
Cdd:PRK10643   3 ILIVEDD--------TLLLQgliLALQTEgyaCDCASTAREAEAllESGHYSLVVLDLGLPDEDGLHLLRRWRQKKYTLP 74

                 ....*
gi 111220137  85 VVVLT 89
Cdd:PRK10643  75 VLILT 79
PEP_resp_reg TIGR02915
PEP-CTERM-box response regulator transcription factor; Members of this protein family share ...
13-90 2.72e-03

PEP-CTERM-box response regulator transcription factor; Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see SP|Q06065). These proteins have a Fis family DNA binding sequence (pfam02954), a response regulator receiver domain (pfam00072), and sigma-54 interaction domain (pfam00158) [Regulatory functions, DNA interactions].


Pssm-ID: 234057 [Multi-domain]  Cd Length: 445  Bit Score: 38.19  E-value: 2.72e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137   13 ILLVEDDDADAYLVSELLDEVAAPVELTRVRTVAeAVRRSKQvSCVLLDLGLPD-----SEGLSALRRLLAVEAGAPVVV 87
Cdd:TIGR02915   1 LLIVEDDLGLQKQLKWSFADYELAVAADRESAIA-LVRRHEP-AVVTLDLGLPPdadgaSEGLAALQQILAIAPDTKVIV 78

                  ...
gi 111220137   88 LTG 90
Cdd:TIGR02915  79 ITG 81
 
Name Accession Description Interval E-value
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
14-127 1.68e-09

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 54.50  E-value: 1.68e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  14 LLVEDDDADAYLVSELLDEvaAPVELTRVRTVAEAVRR--SKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTGL 91
Cdd:cd00156    1 LIVDDDPLIRELLRRLLEK--EGYEVVEAEDGEEALALlaEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAH 78
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 111220137  92 VDEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVRYAI 127
Cdd:cd00156   79 GDDEDAVEALKAGADDYLTK-PFSPEELLARIRALL 113
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
193-383 1.60e-32

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 121.63  E-value: 1.60e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  193 PDGTIHVLLGDVCGHGPDEAALGVSLRIAWRTLVLAGVAEADRLGYLQRVLVSERErDEIFATVCALSIAPDRASLRMRL 272
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLE-GERFATAVLAVYDPETGTLEYAN 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  273 AGHPPPALLHP-RLAALPGDVVGPALGILDEDLTEEVLVELGPRWVLLLATDGLLEGREgPGGEPLGWEGVLpEIAQLWP 351
Cdd:pfam07228  80 AGHPPPLLLRPdGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARD-PDGELFGLERLL-ALLAERH 157
                         170       180       190
                  ....*....|....*....|....*....|..
gi 111220137  352 PDGPDGLLDSLIDRVEARNGGPLTDDVALLLL 383
Cdd:pfam07228 158 GLSPEELLDALLEDLLRLGGGELEDDITLLVL 189
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
164-337 4.37e-19

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 83.55  E-value: 4.37e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137   164 DRQLLHAARYRPGRQqslLGGDFYDMVSTPDGTIHVLLGDVCGHGPDEAALGVSLRIAWRTLVLAGVAEADRLGYLQRVl 243
Cdd:smart00331   1 DDGGLIAQYYEDATQ---VGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRA- 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137   244 VSERERDEIFATVCALSIAPDRASLRMRLAGHPPPALLHP-RLAALPGDVVGPALGILDEDLTEEVLVELGPRWVLLLAT 322
Cdd:smart00331  77 IYENGEDGMFATLFLALYDFAGGTLSYANAGHSPPYLLRAdGGLVEDLDDLGAPLGLEPDVEVDVRELTLEPGDLLLLYT 156
                          170
                   ....*....|....*
gi 111220137   323 DGLLEGREGPGGEPL 337
Cdd:smart00331 157 DGLTEARNPERLEEL 171
CheY COG0784
FOG: CheY-like receiver [Signal transduction mechanisms]
13-133 5.58e-14

FOG: CheY-like receiver [Signal transduction mechanisms]


Pssm-ID: 223855  Cd Length: 130  Bit Score: 67.95  E-value: 5.58e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDDADAYLVSELLDEVAAPVELTRVRTVA--EAVRRSKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTG 90
Cdd:COG0784    8 VLVVDDEPVNRRLLKRLLEDLGYEVVEAADGEEEalELLRELPQPDLILLDINMPGMDGIELLRRLRARGPNIPVILLTA 87
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 111220137  91 LVDEYRGAQAVAAGAQDYLVKGQVDGRDLVRAVRYAIERKRAD 133
Cdd:COG0784   88 YADEADRERALAAGADDYLTKPIFLEEELLAALRRLLARAAAE 130
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
13-124 2.59e-07

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 249561  Cd Length: 111  Bit Score: 47.95  E-value: 2.59e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137   13 ILLVEDDDADAYLVSELLDEVAAPVELTRVRTVAEAVRRSKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTGLV 92
Cdd:pfam00072   1 VLIVDDDPLIRELLRQLLEKEGYVVAEADDGEEALELLKEKRPDLILLDIRMPGMDGLELLRRIRRRPPTTPVIVLTAHG 80
                          90       100       110
                  ....*....|....*....|....*....|..
gi 111220137   93 DEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVR 124
Cdd:pfam00072  81 DEEDAVEALKAGANDFLSK-PFDPEELLAALR 111
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
119-383 7.80e-17

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 79.75  E-value: 7.80e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137 119 LVRAVRYAIERKRADTAAQALRESELraDERARLERGLLPRPLYDDRQLLHAARYRPGRQqslLGGDFYDMVSTPDGTIH 198
Cdd:COG2208  103 INRAVGLVSAHNELLLLEQNNISAEL--EVARQIQQNLLPKALPLFPGIDIEAILVPASE---VGGDYYDFIQLGEKRLR 177
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137 199 VLLGDVCGHGPDEAALGVSLRIAWRTLVLAGVAE-ADRLGYLQRVLVSERERDeIFATVCALSIAPDRASLRMRLAGHPP 277
Cdd:COG2208  178 IGIGDVSGKGVPAALLMLMPKLALRLLLESGPLDpADVLETLNRVLKQNLEED-MFVTLFLGVYDLDSGELTYSNAGHEP 256
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137 278 PALLHPRLAALPGDVV--GPALGILDEDLTEEVLVELGPRWVLLLATDGLLEGReGPGGEPLGWEGvLPEIAQLWPPDGP 355
Cdd:COG2208  257 ALILSADGEIEVEDLTalGLPIGLLPDYQYEVASLQLEPGDLLVLYTDGVTEAR-NSDGEFFGLER-LLKILGRLLGQPA 334
                        250       260
                 ....*....|....*....|....*....
gi 111220137 356 DGLLDSLIDRVEARNGG-PLTDDVALLLL 383
Cdd:COG2208  335 EEILEAILESLEELQGDqIQDDDITLLVL 363
OmpR COG0745
Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding ...
13-151 4.53e-08

Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]


Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 51.91  E-value: 4.53e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDDADAYLVSELLDEvaAPVELTRVRTVAEAVRR-SKQVSCVLLDLGLPDSEGLSALRRLLAVEA-GAPVVVLTG 90
Cdd:COG0745    3 ILLVEDDPELAELLKEYLEE--EGYEVDVAADGEEALEAaREQPDLVLLDLMLPDLDGLELCRRLRAKKGsGPPIIVLTA 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 111220137  91 LVDEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVRYAIERKR---ADTAAQALRESELRADERAR 151
Cdd:COG0745   81 RDDEEDRVLGLEAGADDYLTK-PFSPRELLARLRALLRRNAgasRAEASEVLVFGDLTLDPDTR 143
CitB COG2197
Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain ...
13-159 1.45e-07

Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]


Pssm-ID: 225107 [Multi-domain]  Cd Length: 211  Bit Score: 50.38  E-value: 1.45e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDDadayLVSELLDEVAAPVELTRVRTVA----EAVRRSKQVSC--VLLDLGLPDSEGLSALRRLLAVEAGAPVV 86
Cdd:COG2197    3 VLIVDDHP----LVREGLRQLLELEPDLEVVGEAsngeEALDLARELKPdvVLLDLSMPGMDGLEALKQLRARGPDIKVV 78
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 111220137  87 VLTGLVDEYRGAQAVAAGAQDYLVKGqVDGRDLVRAVRYAIERKR--ADTAAQALRESELRADERARLERGLLPR 159
Cdd:COG2197   79 VLTAHDDPAYVIRALRAGADGYLLKD-ASPEELVEAIRAVAAGGTylPPDIARKLAGLLPSSSAEAPLAELLTPR 152
TtrR COG4566
Response regulator [Signal transduction mechanisms]
12-178 1.73e-07

Response regulator [Signal transduction mechanisms]


Pssm-ID: 226932 [Multi-domain]  Cd Length: 202  Bit Score: 49.98  E-value: 1.73e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  12 PILLVEDDDADAYLVSELLDEVAAPVELTRVRTVAEAVRRSKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTGL 91
Cdd:COG4566    6 LVHVVDDDESVRDALAFLLESAGFQVKCFASAEEFLAAAPLDRPGCLLLDVRMPGMSGLELQDRLAERGIRLPVIFLTGH 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  92 VDEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVRYAIERkradtAAQALRESELRADERARLERgLLPRplydDRQLLHA- 170
Cdd:COG4566   86 GDIPMAVQAMKAGAVDFLEK-PFSEQDLLDAVERALAR-----DASRRAEADRQAAIRARLAT-LTPR----ERQVLDLv 154

                 ....*...
gi 111220137 171 ARYRPGRQ 178
Cdd:COG4566  155 VRGLMNKQ 162
AtoC COG2204
Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains ...
12-157 5.72e-07

Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]


Pssm-ID: 225114 [Multi-domain]  Cd Length: 464  Bit Score: 50.00  E-value: 5.72e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  12 PILLVEDDDADAYLVSELLDEVAAPVEL-TRVRTVAEAVRRSKqVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTG 90
Cdd:COG2204    6 RILVVDDDPDIRELLEQALELAGYEVVTaESAEEALEALSESP-FDLVLLDIRMPGMDGLELLKEIKSRDPDLPVIVMTG 84
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 111220137  91 LVDEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVRYAIERKRADtaaqalRESELRADERARLERGLL 157
Cdd:COG2204   85 HGDIDTAVEALRLGAFDFLEK-PFDLDRLLAIVERALELRELQ------RENRRSLKRAKSLGGELV 144
PRK10643 PRK10643
DNA-binding transcriptional regulator BasR; Provisional
13-89 3.42e-05

DNA-binding transcriptional regulator BasR; Provisional


Pssm-ID: 182612 [Multi-domain]  Cd Length: 222  Bit Score: 43.49  E-value: 3.42e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDdadaylvsELLDE---VAAPVE---LTRVRTVAEAVR--RSKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAP 84
Cdd:PRK10643   3 ILIVEDD--------TLLLQgliLALQTEgyaCDCASTAREAEAllESGHYSLVVLDLGLPDEDGLHLLRRWRQKKYTLP 74

                 ....*
gi 111220137  85 VVVLT 89
Cdd:PRK10643  75 VLILT 79
COG3437 COG3437
Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription ...
1-151 3.58e-05

Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms]


Pssm-ID: 225971 [Multi-domain]  Cd Length: 360  Bit Score: 43.89  E-value: 3.58e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137   1 MPGTEPADVVWPILLVEDDDADAYLVSELLDEVAAPVELTRVRTVAEAVRRSKQVSCVLLDLGLPDSEG---LSALRRLL 77
Cdd:COG3437    5 MQGKNEPDEKLTVLLVDDEPDNLEALRQLLRMIGYRVIEAENGEEALKLLQEEPPDLVLLDVRMPEMDGaevLNKLKAMS 84
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 111220137  78 AVEAGAPVVVLTGLVDEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVRYAIERKRAD--TAAQALRESELRADERAR 151
Cdd:COG3437   85 PSTRRIPVILLTAYADSEDRQRALEAGADDYLSK-PISPKELVARVSSHLQLKRNEdfLLDQNLYLELQELRRRTE 159
PRK11083 PRK11083
DNA-binding response regulator CreB; Provisional
13-180 1.42e-04

DNA-binding response regulator CreB; Provisional


Pssm-ID: 236838 [Multi-domain]  Cd Length: 228  Bit Score: 41.49  E-value: 1.42e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDDADA-YLVSELLDEVAAPVELTRVRTVAEAVRRSkQVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTGL 91
Cdd:PRK11083   6 ILLVEDEQAIAdTLVYALQSEGFTVEWFERGLPALDKLRQQ-PPDLVILDVGLPDISGFELCRQLLAFHPALPVIFLTAR 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  92 VDEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVRYAIER-KRADTAAQALRESELRAD-ERARLERGLLPRPL--YDDRqL 167
Cdd:PRK11083  85 SDEVDRLVGLEIGADDYVAK-PFSPREVAARVRTILRRvKKFAAPSPVIRIGHFELDePAARISYFGTPLTLtrYEFL-L 162
                        170
                 ....*....|...
gi 111220137 168 LHAARYRPGRQQS 180
Cdd:PRK11083 163 LKTLLLSPGRVFS 175
fixJ PRK09390
response regulator FixJ; Provisional
57-168 5.18e-04

response regulator FixJ; Provisional


Pssm-ID: 181815 [Multi-domain]  Cd Length: 202  Bit Score: 39.60  E-value: 5.18e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  57 CVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTGLVDEYRGAQAVAAGAQDYLVKGQVDGRdLVRAVRYAIERkradtAA 136
Cdd:PRK09390  50 CVVTDVRMPGIDGIELLRRLKARGSPLPVIVMTGHGDVPLAVEAMKLGAVDFIEKPFEDER-LIGAIERALAQ-----AP 123
                         90       100       110
                 ....*....|....*....|....*....|..
gi 111220137 137 QALRESELRADERARLERgLLPRplydDRQLL 168
Cdd:PRK09390 124 EAAKSEAVAADIRARIAS-LSER----ERQVM 150
PleD COG3706
Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal ...
13-151 8.57e-04

Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms]


Pssm-ID: 226229 [Multi-domain]  Cd Length: 435  Bit Score: 39.61  E-value: 8.57e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDDADAYLVSELLDEVAApvELTRVRTVAEAVRRSKQ--VSCVLLDLGLPDSEGLSALRRLLAVEA--GAPVVVL 88
Cdd:COG3706  135 ILVVDDDATQRERLRRILQVEGF--RVVEATDGEEALLQLAElpPDLVLLDANMPDMDGLELCTRLRQLERtrDIPIILL 212
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 111220137  89 TGLVDEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVRYAIERKRADtaaQALRESELRADERAR 151
Cdd:COG3706  213 SSKDDDELVVRAFELGVNDYITK-PIEEGELRARLRRQLRRKRYE---RQLRESLERLQELAL 271
ompR PRK09468
osmolarity response regulator; Provisional
13-138 1.00e-03

osmolarity response regulator; Provisional


Pssm-ID: 181883 [Multi-domain]  Cd Length: 239  Bit Score: 39.19  E-value: 1.00e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDDADAYLVSELLDEvaapvELTRVRTVAEAVRRSK-----QVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVV 87
Cdd:PRK09468   8 ILVVDDDMRLRALLERYLTE-----QGFQVRSAANAEQMDRlltreSFHLMVLDLMLPGEDGLSICRRLRSQNNPTPIIM 82
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 111220137  88 LTGLVDEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVRyAIERKRADTAAQA 138
Cdd:PRK09468  83 LTAKGEEVDRIVGLEIGADDYLPK-PFNPRELLARIR-AVLRRQAPELPGA 131
PRK10529 PRK10529
DNA-binding transcriptional activator KdpE; Provisional
13-152 1.61e-03

DNA-binding transcriptional activator KdpE; Provisional


Pssm-ID: 182522 [Multi-domain]  Cd Length: 225  Bit Score: 38.25  E-value: 1.61e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDDADAYLVSELLDEVAAPV--ELTRVRTVAEAVRRSKQVscVLLDLGLPDSEGLSALRRLLAVEAgAPVVVLTG 90
Cdd:PRK10529   4 VLIVEDEQAIRRFLRTALEGDGMRVfeAETLQRGLLEAATRKPDL--IILDLGLPDGDGIEFIRDLRQWSA-IPVIVLSA 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 111220137  91 LVDEYRGAQAVAAGAQDYLVKGQVDGRDLVRaVRYAIERKRADTAAQAL-RESELRADERARL 152
Cdd:PRK10529  81 RSEESDKIAALDAGADDYLSKPFGIGELQAR-LRVALRRHSATPAPDPLvKFSDVTVDLAARV 142
PEP_resp_reg TIGR02915
PEP-CTERM-box response regulator transcription factor; Members of this protein family share ...
13-90 2.72e-03

PEP-CTERM-box response regulator transcription factor; Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see SP|Q06065). These proteins have a Fis family DNA binding sequence (pfam02954), a response regulator receiver domain (pfam00072), and sigma-54 interaction domain (pfam00158) [Regulatory functions, DNA interactions].


Pssm-ID: 234057 [Multi-domain]  Cd Length: 445  Bit Score: 38.19  E-value: 2.72e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137   13 ILLVEDDDADAYLVSELLDEVAAPVELTRVRTVAeAVRRSKQvSCVLLDLGLPD-----SEGLSALRRLLAVEAGAPVVV 87
Cdd:TIGR02915   1 LLIVEDDLGLQKQLKWSFADYELAVAADRESAIA-LVRRHEP-AVVTLDLGLPPdadgaSEGLAALQQILAIAPDTKVIV 78

                  ...
gi 111220137   88 LTG 90
Cdd:TIGR02915  79 ITG 81
HipA COG3550
Toxin module HipA, protein kinase of phosphatidylinositol 3/4-kinase superfamily [General ...
228-360 4.16e-03

Toxin module HipA, protein kinase of phosphatidylinositol 3/4-kinase superfamily [General function prediction only]


Pssm-ID: 226080 [Multi-domain]  Cd Length: 392  Bit Score: 37.43  E-value: 4.16e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137 228 AGVAEADRLGYLQRVLVSERERDEIFATVCALSIAPDRA-SLRMRLAGHPPPALLHPRLAALPGDVVGPALGILDEDLTE 306
Cdd:COG3550  117 AGVAGADALTALLRKASGIPDGITPTVHIIKAPDGLYAVkSNSDRISTSIDKELDALRYPEAAGLEVLCMEAARQGGVAV 196
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 111220137 307 EVLVELGPRWVLLLATDGLLegregPGGEPLGWEGvLPEIAQLWPPDGPDGLLD 360
Cdd:COG3550  197 LALERFERRSVLIVTRFDRL-----PQEGKIQVEG-LPATLKYEPNDGYGGYEA 244
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
13-81 4.73e-03

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072) [Signal transduction, Two-component systems].


Pssm-ID: 234070 [Multi-domain]  Cd Length: 968  Bit Score: 37.84  E-value: 4.73e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 111220137   13 ILLVEDDDADAYLVSELLDEVAAPVelTRVRTVAEAVR--RSKQVSCVLLDLGLPDSEGLSALRRLLAVEA 81
Cdd:TIGR02956 705 VLLVEDNEVNQMVAQGFLTRLGHKV--TLAESGQSALEcfHQHAFDLALLDINLPDGDGVTLLQQLRAIYG 773
PRK09836 PRK09836
DNA-binding transcriptional activator CusR; Provisional
13-151 6.81e-03

DNA-binding transcriptional activator CusR; Provisional


Pssm-ID: 182102 [Multi-domain]  Cd Length: 227  Bit Score: 36.44  E-value: 6.81e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDDADAYLVSELLDEVAAPVELTRVRTVAEAVRRSKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTGLV 92
Cdd:PRK09836   3 LLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTALG 82
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 111220137  93 DEYRGAQAVAAGAQDYLVKGQVDGRDLVRaVRYAIERKRADTAAQALRESELRADERAR 151
Cdd:PRK09836  83 TIEHRVKGLELGADDYLVKPFAFAELLAR-VRTLLRRGAAVIIESQFQVADLMVDLVSR 140
PRK13558 PRK13558
bacterio-opsin activator; Provisional
13-95 8.23e-03

bacterio-opsin activator; Provisional


Pssm-ID: 237426 [Multi-domain]  Cd Length: 665  Bit Score: 36.74  E-value: 8.23e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDDADAYLVSELldEVAAPVELTRVRTVAEAVRR--SKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTG 90
Cdd:PRK13558  10 VLFVGDDPEAGPVDCDL--DEDGRLDVTQIRDFVAARDRveAGEIDCVVADHEPDGFDGLALLEAVRQTTAVPPVVVVPT 87

                 ....*
gi 111220137  91 LVDEY 95
Cdd:PRK13558  88 AGDEA 92
PRK11361 PRK11361
acetoacetate metabolism regulatory protein AtoC; Provisional
13-142 9.02e-03

acetoacetate metabolism regulatory protein AtoC; Provisional


Pssm-ID: 183099 [Multi-domain]  Cd Length: 457  Bit Score: 36.75  E-value: 9.02e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111220137  13 ILLVEDDDADAYLVSELLDEVAAPVELTRVRTVAEAVRRSKQVSCVLLDLGLPDSEGLSALRRLLAVEAGAPVVVLTGLV 92
Cdd:PRK11361   7 ILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGIKALKEMRSHETRTPVILMTAYA 86
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 111220137  93 DEYRGAQAVAAGAQDYLVKgQVDGRDLVRAVRYAIERK--RADTAA--QALRES 142
Cdd:PRK11361  87 EVETAVEALRCGAFDYVIK-PFDLDELNLIVQRALQLQsmKKEIRHlhQALSTS 139
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH