NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|111154059|ref|NP_031955|]
View 

epithelial membrane protein 2 [Mus musculus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PMP22_Claudin pfam00822
PMP-22/EMP/MP20/Claudin family;
1-165 1.01e-55

PMP-22/EMP/MP20/Claudin family;


:

Pssm-ID: 250157  Cd Length: 161  Bit Score: 175.25  E-value: 1.01e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111154059    1 MLVILAFIIVFHIVSTALLFISTIDNAWWVGDSF----SADLWRVCTNSTNCTEINELtgpeAFEGYSVMQAVQATMILS 76
Cdd:pfam00822   1 MLVLLLGFIVSHIAWVILLFVATIPDQWKVSRYVgaaaSAGLWRNCTTQSCTGQISCK----VLELNDALQAVQALMILS 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111154059   77 TILSCISFLIFLLQLFRLKQGERFVLTSIIQLMSCLCVMIGASIYTDRRQDLHQQNRKlyylLQEGSYGYSFILAWVAFA 156
Cdd:pfam00822  77 IILGIISLIVFFFQLFTMRKGGRFKLAGIIFLVSGLCVLVGASIYTSRIATDFGNPFT----NRKYSFGYSFILGWVAFA 152

                  ....*....
gi 111154059  157 FTFISGLMY 165
Cdd:pfam00822 153 LAFIGGVLY 161
 
Name Accession Description Interval E-value
PMP22_Claudin pfam00822
PMP-22/EMP/MP20/Claudin family;
1-165 1.01e-55

PMP-22/EMP/MP20/Claudin family;


Pssm-ID: 250157  Cd Length: 161  Bit Score: 175.25  E-value: 1.01e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111154059    1 MLVILAFIIVFHIVSTALLFISTIDNAWWVGDSF----SADLWRVCTNSTNCTEINELtgpeAFEGYSVMQAVQATMILS 76
Cdd:pfam00822   1 MLVLLLGFIVSHIAWVILLFVATIPDQWKVSRYVgaaaSAGLWRNCTTQSCTGQISCK----VLELNDALQAVQALMILS 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111154059   77 TILSCISFLIFLLQLFRLKQGERFVLTSIIQLMSCLCVMIGASIYTDRRQDLHQQNRKlyylLQEGSYGYSFILAWVAFA 156
Cdd:pfam00822  77 IILGIISLIVFFFQLFTMRKGGRFKLAGIIFLVSGLCVLVGASIYTSRIATDFGNPFT----NRKYSFGYSFILGWVAFA 152

                  ....*....
gi 111154059  157 FTFISGLMY 165
Cdd:pfam00822 153 LAFIGGVLY 161
 
Name Accession Description Interval E-value
PMP22_Claudin pfam00822
PMP-22/EMP/MP20/Claudin family;
1-165 1.01e-55

PMP-22/EMP/MP20/Claudin family;


Pssm-ID: 250157  Cd Length: 161  Bit Score: 175.25  E-value: 1.01e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111154059    1 MLVILAFIIVFHIVSTALLFISTIDNAWWVGDSF----SADLWRVCTNSTNCTEINELtgpeAFEGYSVMQAVQATMILS 76
Cdd:pfam00822   1 MLVLLLGFIVSHIAWVILLFVATIPDQWKVSRYVgaaaSAGLWRNCTTQSCTGQISCK----VLELNDALQAVQALMILS 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111154059   77 TILSCISFLIFLLQLFRLKQGERFVLTSIIQLMSCLCVMIGASIYTDRRQDLHQQNRKlyylLQEGSYGYSFILAWVAFA 156
Cdd:pfam00822  77 IILGIISLIVFFFQLFTMRKGGRFKLAGIIFLVSGLCVLVGASIYTSRIATDFGNPFT----NRKYSFGYSFILGWVAFA 152

                  ....*....
gi 111154059  157 FTFISGLMY 165
Cdd:pfam00822 153 LAFIGGVLY 161
Claudin_2 pfam13903
PMP-22/EMP/MP20/Claudin tight junction; Members of this family are claudins, that form tight ...
13-165 2.08e-06

PMP-22/EMP/MP20/Claudin tight junction; Members of this family are claudins, that form tight junctions between cells.


Pssm-ID: 290614  Cd Length: 190  Bit Score: 44.32  E-value: 2.08e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111154059   13 IVSTALLFISTIDNAWWVGDSFSAD------------LWRVCTNSTNCTEIN---------------ELTGPEAFEGYSV 65
Cdd:pfam13903   1 ILAFALLLIAFGTDYWLVLDVRLTGyqnanalfahlgLWRICFRSEVDPDSDydtrffgclnqvpnpFPTFEEEIVSFSD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 111154059   66 M------QAVQATMILSTILSCISFLIFLLQLFRLKQGeRFVLTSIIQLMSCLCVMIGASIY----------TDRRQDLH 129
Cdd:pfam13903  81 PslpgltRFVQAFAILSLVLIVCGVVCGLLALPKQSVF-LLLAAGILFLLSGVLGLLGVIVFiqsvklvfdyFRQWMPEH 159
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 111154059  130 QQNRKLyyllqegSYGYSFILAWVAFAFTFISGLMY 165
Cdd:pfam13903 160 QNNVRI-------SFGWSFALAWAGVVLCLVAGLLF 188
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH