NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|110611243|ref|NP_002522|]
View 

neurotensin receptor type 1 [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_4 super family cl21561
Olfactory receptor; The members of this family are transmembrane olfactory receptors.
159-381 2.01e-05

Olfactory receptor; The members of this family are transmembrane olfactory receptors.


The actual alignment was detected with superfamily member pfam10323:

Pssm-ID: 271981  Cd Length: 283  Bit Score: 44.53  E-value: 2.01e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  159 VASLSVERYLAICHP-FKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADgqhagglvctpTIHTATVKVVI 237
Cdd:pfam10323  93 ISFLSTNRYLAICFPiSRLTKIWQSARLWKIILIYWLPGLLISLVVLKNTDIYYDNEE-----------NMPVVADKDVI 161
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  238 QVNTFMSFIFpmVVISVLNTIIANKLT-VMVRQAAEQgqvctvggeHSTfsmaiepGRVQALRHGVRVLRAVVIAFVVCW 316
Cdd:pfam10323 162 QRFTLIALIF--VFVTCIYCIIAYGALfFVIRKKFNK---------NSQ-------TKSKSLKREVRLAFQVFILVLAFL 223
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 110611243  317 lpyhvrrLMFCYisdeqwtpFLYDFYHYFYMVTNALFYVS----------STINPILYNLVSANFRHIFLATLAC 381
Cdd:pfam10323 224 -------IILIF--------YILSNYFSQTQNTDPIFYLRalypiasgllSYINPYLLLIFNRDLRKQVRKMLKC 283
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
120-364 7.32e-45

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


:

Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 157.47  E-value: 7.32e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  120 MPVELYNFiwVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALL 199
Cdd:pfam00001  32 PPWALYYL--VGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAKVLILVVWVLALLL 109
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  200 AVPMLFtMGEQNRSADGQHAgglVCTPT-IHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAeqgqvct 278
Cdd:pfam00001 110 SLPPLL-FSWLRTVEEGNVT---TCLIDfPEESTLRSYTLLSTLLGFVLPLLVILVCYTLILRTLRKRARSGA------- 178
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  279 vggehstfSMAIEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWtpflyDFYHYFYMVTNALFYVSST 358
Cdd:pfam00001 179 --------SQARAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSII-----RLLPTALLITLWLAYVNSC 245

                  ....*.
gi 110611243  359 INPILY 364
Cdd:pfam00001 246 LNPIIY 251
 
Name Accession Description Interval E-value
7TM_GPCR_Srv pfam10323
Serpentine type 7TM GPCR chemoreceptor Srv; Chemoreception is mediated in Caenorhabditis ...
159-381 2.01e-05

Serpentine type 7TM GPCR chemoreceptor Srv; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srv is a member of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


Pssm-ID: 255906  Cd Length: 283  Bit Score: 44.53  E-value: 2.01e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  159 VASLSVERYLAICHP-FKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADgqhagglvctpTIHTATVKVVI 237
Cdd:pfam10323  93 ISFLSTNRYLAICFPiSRLTKIWQSARLWKIILIYWLPGLLISLVVLKNTDIYYDNEE-----------NMPVVADKDVI 161
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  238 QVNTFMSFIFpmVVISVLNTIIANKLT-VMVRQAAEQgqvctvggeHSTfsmaiepGRVQALRHGVRVLRAVVIAFVVCW 316
Cdd:pfam10323 162 QRFTLIALIF--VFVTCIYCIIAYGALfFVIRKKFNK---------NSQ-------TKSKSLKREVRLAFQVFILVLAFL 223
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 110611243  317 lpyhvrrLMFCYisdeqwtpFLYDFYHYFYMVTNALFYVS----------STINPILYNLVSANFRHIFLATLAC 381
Cdd:pfam10323 224 -------IILIF--------YILSNYFSQTQNTDPIFYLRalypiasgllSYINPYLLLIFNRDLRKQVRKMLKC 283
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
120-364 7.32e-45

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 157.47  E-value: 7.32e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  120 MPVELYNFiwVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALL 199
Cdd:pfam00001  32 PPWALYYL--VGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAKVLILVVWVLALLL 109
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  200 AVPMLFtMGEQNRSADGQHAgglVCTPT-IHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAeqgqvct 278
Cdd:pfam00001 110 SLPPLL-FSWLRTVEEGNVT---TCLIDfPEESTLRSYTLLSTLLGFVLPLLVILVCYTLILRTLRKRARSGA------- 178
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  279 vggehstfSMAIEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWtpflyDFYHYFYMVTNALFYVSST 358
Cdd:pfam00001 179 --------SQARAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSII-----RLLPTALLITLWLAYVNSC 245

                  ....*.
gi 110611243  359 INPILY 364
Cdd:pfam00001 246 LNPIIY 251
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
63-371 1.33e-09

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 57.87  E-value: 1.33e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  63 KVLVTAVYLALFVVGTVGNtVTAFTLARKKSLQSLQSTVHYHLgslaLSDLLTLLLAMPVELYNFIWVHhpWAFGDAGCR 142
Cdd:PHA03087  40 STILIVVYSTIFFFGLVGN-IIVIYVLTKTKIKTPMDIYLLNL----AVSDLLFVMTLPFQIYYYILFQ--WSFGEFACK 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243 143 GYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTmgeqnrSADGQHAGGL 222
Cdd:PHA03087 113 IVSGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFV------YTTKKDHETL 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243 223 VCTPTIHTATVKVVIQVN---TFMSFIFPMVVISVLNTIIANKLTVMVRQAAEqgqvctvggehstfsmaiepgrvqalR 299
Cdd:PHA03087 187 ICCMFYNNKTMNWKLFINfeiNIIGMLIPLTILLYCYSKILITLKGINKSKKN--------------------------K 240
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110611243 300 HGVRVLRAVVIAFVVCWLPYHVRRLMFC-YISDEQWTPFLYDFYHYFYMVTNALFYVSSTINPILYNLVSANF 371
Cdd:PHA03087 241 KAIKLVLIIVILFVIFWLPFNVSVFVYSlHILHFKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFF 313
 
Name Accession Description Interval E-value
7TM_GPCR_Srv pfam10323
Serpentine type 7TM GPCR chemoreceptor Srv; Chemoreception is mediated in Caenorhabditis ...
159-381 2.01e-05

Serpentine type 7TM GPCR chemoreceptor Srv; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srv is a member of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


Pssm-ID: 255906  Cd Length: 283  Bit Score: 44.53  E-value: 2.01e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  159 VASLSVERYLAICHP-FKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADgqhagglvctpTIHTATVKVVI 237
Cdd:pfam10323  93 ISFLSTNRYLAICFPiSRLTKIWQSARLWKIILIYWLPGLLISLVVLKNTDIYYDNEE-----------NMPVVADKDVI 161
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  238 QVNTFMSFIFpmVVISVLNTIIANKLT-VMVRQAAEQgqvctvggeHSTfsmaiepGRVQALRHGVRVLRAVVIAFVVCW 316
Cdd:pfam10323 162 QRFTLIALIF--VFVTCIYCIIAYGALfFVIRKKFNK---------NSQ-------TKSKSLKREVRLAFQVFILVLAFL 223
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 110611243  317 lpyhvrrLMFCYisdeqwtpFLYDFYHYFYMVTNALFYVS----------STINPILYNLVSANFRHIFLATLAC 381
Cdd:pfam10323 224 -------IILIF--------YILSNYFSQTQNTDPIFYLRalypiasgllSYINPYLLLIFNRDLRKQVRKMLKC 283
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
120-364 7.32e-45

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 157.47  E-value: 7.32e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  120 MPVELYNFiwVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALL 199
Cdd:pfam00001  32 PPWALYYL--VGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAKVLILVVWVLALLL 109
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  200 AVPMLFtMGEQNRSADGQHAgglVCTPT-IHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAeqgqvct 278
Cdd:pfam00001 110 SLPPLL-FSWLRTVEEGNVT---TCLIDfPEESTLRSYTLLSTLLGFVLPLLVILVCYTLILRTLRKRARSGA------- 178
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  279 vggehstfSMAIEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWtpflyDFYHYFYMVTNALFYVSST 358
Cdd:pfam00001 179 --------SQARAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSII-----RLLPTALLITLWLAYVNSC 245

                  ....*.
gi 110611243  359 INPILY 364
Cdd:pfam00001 246 LNPIIY 251
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
63-371 1.33e-09

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 57.87  E-value: 1.33e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  63 KVLVTAVYLALFVVGTVGNtVTAFTLARKKSLQSLQSTVHYHLgslaLSDLLTLLLAMPVELYNFIWVHhpWAFGDAGCR 142
Cdd:PHA03087  40 STILIVVYSTIFFFGLVGN-IIVIYVLTKTKIKTPMDIYLLNL----AVSDLLFVMTLPFQIYYYILFQ--WSFGEFACK 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243 143 GYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTmgeqnrSADGQHAGGL 222
Cdd:PHA03087 113 IVSGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFV------YTTKKDHETL 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243 223 VCTPTIHTATVKVVIQVN---TFMSFIFPMVVISVLNTIIANKLTVMVRQAAEqgqvctvggehstfsmaiepgrvqalR 299
Cdd:PHA03087 187 ICCMFYNNKTMNWKLFINfeiNIIGMLIPLTILLYCYSKILITLKGINKSKKN--------------------------K 240
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110611243 300 HGVRVLRAVVIAFVVCWLPYHVRRLMFC-YISDEQWTPFLYDFYHYFYMVTNALFYVSSTINPILYNLVSANF 371
Cdd:PHA03087 241 KAIKLVLIIVILFVIFWLPFNVSVFVYSlHILHFKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFF 313
PHA02638 PHA02638
CC chemokine receptor-like protein; Provisional
66-405 7.66e-08

CC chemokine receptor-like protein; Provisional


Pssm-ID: 165021 [Multi-domain]  Cd Length: 417  Bit Score: 52.71  E-value: 7.66e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243  66 VTAVYLALFVVGTVGNTVTAFTLARKKsLQSLQSTVHYHLGslalSDLLTLLLAMPVELYNFIwvhHPWAFGDAGCR--- 142
Cdd:PHA02638 101 IKIFYIIIFILGLFGNAAIIMILFCKK-IKTITDIYIFNLA----ISDLIFVIDFPFIIYNEF---DQWIFGDFMCKvis 172
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243 143 -GYYFlrdaCTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAGG 221
Cdd:PHA02638 173 aSYYI----GFFSNMFLITLMSIDRYFAILYPISFQKYRTFNIGIILCIISWILSLIITSPAYFIFEASNIIFSAQDSNE 248
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243 222 LV----CTPTIHTATVKVVI--QVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVctvggehstfsmaiepgrv 295
Cdd:PHA02638 249 TIsnyqCTLIEDNEKNNISFlgRILQFEINILGMFIPIIIFAFCYIKIILKLKQLKKSKKT------------------- 309
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110611243 296 qalrHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDF------YHYFYMVTNALFYVSSTINPILYNLVSA 369
Cdd:PHA02638 310 ----KSIIIVSIIIICSLICWIPLNIVILFATMYSFKGFNSIISEHicgfikLGYAMMLAEAISLTHCCINPLIYTLIGE 385
                        330       340       350
                 ....*....|....*....|....*....|....*..
gi 110611243 370 NFR-HIFLatlaclcpVWRRRRKRPAFSRKADSVSSN 405
Cdd:PHA02638 386 NFRmHLLM--------IFRNIFTNAKFSFRKSSISSS 414
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH