NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|109083851|ref|XP_001097345|]
View 

PREDICTED: probable sodium-coupled neutral amino acid transporter 6 [Macaca mulatta]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Aa_trans super family cl17468
Transmembrane amino acid transporter protein; This transmembrane region is found in many amino ...
46-451 6.15e-57

Transmembrane amino acid transporter protein; This transmembrane region is found in many amino acid transporters including UNC-47 and MTR. UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT). UNC-47 is predicted to have 10 transmembrane domains. MTR is a N system amino acid transporter system protein involved in methyltryptophan resistance. Other members of this family include proline transporters and amino acid permeases.


The actual alignment was detected with superfamily member pfam01490:

Pssm-ID: 266708  Cd Length: 405  Bit Score: 195.21  E-value: 6.15e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851   46 SFGLSVFNLMNAIMGSGILGLAFIMANTGILGFSFLLLTVALLASYSVHLLLSMCIQTAVT-----SYEDLGLFAFGLPG 120
Cdd:pfam01490   4 SAWQAVFNLINAIIGAGVLGLPYAFKQLGWIPGLILLVIVGLISLYTLHLLVRCSKEVDVTgkrnkSYGDLGYRLFGPKG 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  121 KVVVAGTIIIQNIGAMSSYLLIIKTEFPAAIAEFLTGdysrywYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFF 200
Cdd:pfam01490  84 RLLILFAILLNLFGVCISYLIFAGDNLPAIFDSFFDT------CPISLVYFIIIFGLIFIPLSFIPNLSALSILSLLAAV 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  201 FMMFFALVVIIkkwsipcpltlNYVEKCFQISNATDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSK-K 279
Cdd:pfam01490 158 SSLYYIVILVL-----------SVAELGVLTAQGVGYLGSKTNIKLARTFLAIGIIVFAFEGHAVLLPIQNTMKSPSKfK 226
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  280 RMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYlphDVVVMTVKLCMLFAVLLTVPLIHFPARKAVMMMF 359
Cdd:pfam01490 227 AMTKILLVAIIIVTVLYILIGLVGYLAFGDNVKGNILLNLPKS---DWLIDIANLLLVIHLLLSFPLQAFPIRQIVENLL 303
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  360 FS------NFPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLS----WKKF 429
Cdd:pfam01490 304 FRkgasgkHNPKSKLLRVVIRSGLVVITYLIAISVPFFGDLLSLVGATSCAPLSFILPPLFHLKLKKTKKKSleklWKPI 383
                         410       420
                  ....*....|....*....|..
gi 109083851  430 GAFVLLIFGILVGNFSLALIIF 451
Cdd:pfam01490 384 LDVICIVIGLLLMAYGVAGLIL 405
SdaC COG0814
Amino acid permeases [Amino acid transport and metabolism]
50-451 4.14e-19

Amino acid permeases [Amino acid transport and metabolism]


:

Pssm-ID: 223884 [Multi-domain]  Cd Length: 415  Bit Score: 87.71  E-value: 4.14e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  50 SVFNLMNAIMGSGILGLAFIMANTGILgFSFLLLTVALLASYSVHLLLSMCIQTA---VTSYEDLGLFAFGLPGKVVVAG 126
Cdd:COG0814   14 GVLILAGTAIGAGVLFLPVAFGGGGFW-PGLLLLIIAWPLTYLSLLLLLEALLSSpngKASITSLVEDYLGKKGGILIGL 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 127 TIIIQNIGAMSSYLLIIKTEFPAAIAEFLTGDYSRYWyldgqtLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFA 206
Cdd:COG0814   93 SYFFALYGLLVAYIVGIGNLLASFLGNQFGLNPLPRK------LGSLIFALVLAFLSWLGTLAVLKITSLLVFGKVIYLV 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 207 LVVIikkWSIPCPLTLNYVEKCFqisnatddckpKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKRMQNVTN 286
Cdd:COG0814  167 LLVV---YLIPHWNPANLFALPS-----------ASQSFWKYLLLAIPVFVFSFGFHGNIPSLVNYMRKNSKKAVRKAIL 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 287 TAIALSFLIYFISALFGYLTFYDKVESELLKGY----------SKYLPHDVVVMTVKLCMLFAVL---LTVPLIHFPARK 353
Cdd:COG0814  233 IGSLIALVLYILVGFFVFGCFGSLVFGNILAAKeqnisllsalAGVINSPILSIALNIFALFAIAtsfLGVYLGLFEGLA 312
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 354 AVMMM--FFSNFPFSWIRHFLITLAL-NIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKFG 430
Cdd:COG0814  313 DLFKKsnSKPGRKKTGLLTFLPPLIFaLLYPWGFAIALGYAGGLIATIGAPIIPALLFIKPRKLIYKLPALKVYGGNFLL 392
                        410       420
                 ....*....|....*....|.
gi 109083851 431 AFVLLIFGILVGNFSLALIIF 451
Cdd:COG0814  393 LLLVLLFGILVILSPFLATFG 413
 
Name Accession Description Interval E-value
Aa_trans pfam01490
Transmembrane amino acid transporter protein; This transmembrane region is found in many amino ...
46-451 6.15e-57

Transmembrane amino acid transporter protein; This transmembrane region is found in many amino acid transporters including UNC-47 and MTR. UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT). UNC-47 is predicted to have 10 transmembrane domains. MTR is a N system amino acid transporter system protein involved in methyltryptophan resistance. Other members of this family include proline transporters and amino acid permeases.


Pssm-ID: 250658  Cd Length: 405  Bit Score: 195.21  E-value: 6.15e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851   46 SFGLSVFNLMNAIMGSGILGLAFIMANTGILGFSFLLLTVALLASYSVHLLLSMCIQTAVT-----SYEDLGLFAFGLPG 120
Cdd:pfam01490   4 SAWQAVFNLINAIIGAGVLGLPYAFKQLGWIPGLILLVIVGLISLYTLHLLVRCSKEVDVTgkrnkSYGDLGYRLFGPKG 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  121 KVVVAGTIIIQNIGAMSSYLLIIKTEFPAAIAEFLTGdysrywYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFF 200
Cdd:pfam01490  84 RLLILFAILLNLFGVCISYLIFAGDNLPAIFDSFFDT------CPISLVYFIIIFGLIFIPLSFIPNLSALSILSLLAAV 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  201 FMMFFALVVIIkkwsipcpltlNYVEKCFQISNATDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSK-K 279
Cdd:pfam01490 158 SSLYYIVILVL-----------SVAELGVLTAQGVGYLGSKTNIKLARTFLAIGIIVFAFEGHAVLLPIQNTMKSPSKfK 226
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  280 RMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYlphDVVVMTVKLCMLFAVLLTVPLIHFPARKAVMMMF 359
Cdd:pfam01490 227 AMTKILLVAIIIVTVLYILIGLVGYLAFGDNVKGNILLNLPKS---DWLIDIANLLLVIHLLLSFPLQAFPIRQIVENLL 303
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  360 FS------NFPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLS----WKKF 429
Cdd:pfam01490 304 FRkgasgkHNPKSKLLRVVIRSGLVVITYLIAISVPFFGDLLSLVGATSCAPLSFILPPLFHLKLKKTKKKSleklWKPI 383
                         410       420
                  ....*....|....*....|..
gi 109083851  430 GAFVLLIFGILVGNFSLALIIF 451
Cdd:pfam01490 384 LDVICIVIGLLLMAYGVAGLIL 405
PTZ00206 PTZ00206
amino acid transporter; Provisional
50-451 3.07e-18

amino acid transporter; Provisional


Pssm-ID: 240313  Cd Length: 467  Bit Score: 85.69  E-value: 3.07e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  50 SVFNLMNAIMGSGILGLAFIMANTGILGFSFLLLTVALLASYSVHLLLSMCIQTAVTSYEDLGLFAFGLPGKVVVAGTII 129
Cdd:PTZ00206  65 SAFNIASSTVGAGIVGLPSAANSSGLVMAMIYLIIITAMTIFSIYALGVAADKTNIRTYEGVARVLLGPWGSYYVAATRA 144
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 130 IQNIGAMSSYLLIIKTEFPAAIAEFLTGDYSRYWYlDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVV 209
Cdd:PTZ00206 145 FHGFSACVAYVISVGDILSATLKGTNAPDFLKQKS-GNRLLTSLMWLCFMLPLVIPRHIDSLRYVSTIAVSFMVYLVIVI 223
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 210 IIKKWSIPCPLTLNYVEkcfqiSNATDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKRMQNVTNTAI 289
Cdd:PTZ00206 224 VVHSCMNGLPENIKNVS-----VGKDDNAEIILFNSGNRAIEGLGVFIFAYVFQITAYEVYMDMTNRSVGKFVLASTIAM 298
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 290 ALSFLIYFISALFGYLTFYDKVESELLKGYSKYLPHDVVV----MTVKLCMLFAVLltvpliHFPARKAVMMMFFSNF-P 364
Cdd:PTZ00206 299 GMCFTMYVLTAFFGYMDFGRNVTGSVLLMYDPVNEPAIMVgfvgVLVKLFVSYALL------GMACRNALYDVIGWDArK 372
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 365 FSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLklsREDFLSWKKFGAF------VLLIFG 438
Cdd:PTZ00206 373 VAFWKHCIAVVTLSVVMLLCGLFIPKINTVLGFAGSISGGLLGFILPALLFM---YSGGFTWQKVGPFyyistyVVLITG 449
                        410
                 ....*....|...
gi 109083851 439 ILVGNFSLALIIF 451
Cdd:PTZ00206 450 VIAIVFGTGATIW 462
SdaC COG0814
Amino acid permeases [Amino acid transport and metabolism]
50-451 4.14e-19

Amino acid permeases [Amino acid transport and metabolism]


Pssm-ID: 223884 [Multi-domain]  Cd Length: 415  Bit Score: 87.71  E-value: 4.14e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  50 SVFNLMNAIMGSGILGLAFIMANTGILgFSFLLLTVALLASYSVHLLLSMCIQTA---VTSYEDLGLFAFGLPGKVVVAG 126
Cdd:COG0814   14 GVLILAGTAIGAGVLFLPVAFGGGGFW-PGLLLLIIAWPLTYLSLLLLLEALLSSpngKASITSLVEDYLGKKGGILIGL 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 127 TIIIQNIGAMSSYLLIIKTEFPAAIAEFLTGDYSRYWyldgqtLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFA 206
Cdd:COG0814   93 SYFFALYGLLVAYIVGIGNLLASFLGNQFGLNPLPRK------LGSLIFALVLAFLSWLGTLAVLKITSLLVFGKVIYLV 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 207 LVVIikkWSIPCPLTLNYVEKCFqisnatddckpKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKRMQNVTN 286
Cdd:COG0814  167 LLVV---YLIPHWNPANLFALPS-----------ASQSFWKYLLLAIPVFVFSFGFHGNIPSLVNYMRKNSKKAVRKAIL 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 287 TAIALSFLIYFISALFGYLTFYDKVESELLKGY----------SKYLPHDVVVMTVKLCMLFAVL---LTVPLIHFPARK 353
Cdd:COG0814  233 IGSLIALVLYILVGFFVFGCFGSLVFGNILAAKeqnisllsalAGVINSPILSIALNIFALFAIAtsfLGVYLGLFEGLA 312
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 354 AVMMM--FFSNFPFSWIRHFLITLAL-NIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKFG 430
Cdd:COG0814  313 DLFKKsnSKPGRKKTGLLTFLPPLIFaLLYPWGFAIALGYAGGLIATIGAPIIPALLFIKPRKLIYKLPALKVYGGNFLL 392
                        410       420
                 ....*....|....*....|.
gi 109083851 431 AFVLLIFGILVGNFSLALIIF 451
Cdd:COG0814  393 LLLVLLFGILVILSPFLATFG 413
 
Name Accession Description Interval E-value
Aa_trans pfam01490
Transmembrane amino acid transporter protein; This transmembrane region is found in many amino ...
46-451 6.15e-57

Transmembrane amino acid transporter protein; This transmembrane region is found in many amino acid transporters including UNC-47 and MTR. UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT). UNC-47 is predicted to have 10 transmembrane domains. MTR is a N system amino acid transporter system protein involved in methyltryptophan resistance. Other members of this family include proline transporters and amino acid permeases.


Pssm-ID: 250658  Cd Length: 405  Bit Score: 195.21  E-value: 6.15e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851   46 SFGLSVFNLMNAIMGSGILGLAFIMANTGILGFSFLLLTVALLASYSVHLLLSMCIQTAVT-----SYEDLGLFAFGLPG 120
Cdd:pfam01490   4 SAWQAVFNLINAIIGAGVLGLPYAFKQLGWIPGLILLVIVGLISLYTLHLLVRCSKEVDVTgkrnkSYGDLGYRLFGPKG 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  121 KVVVAGTIIIQNIGAMSSYLLIIKTEFPAAIAEFLTGdysrywYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFF 200
Cdd:pfam01490  84 RLLILFAILLNLFGVCISYLIFAGDNLPAIFDSFFDT------CPISLVYFIIIFGLIFIPLSFIPNLSALSILSLLAAV 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  201 FMMFFALVVIIkkwsipcpltlNYVEKCFQISNATDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSK-K 279
Cdd:pfam01490 158 SSLYYIVILVL-----------SVAELGVLTAQGVGYLGSKTNIKLARTFLAIGIIVFAFEGHAVLLPIQNTMKSPSKfK 226
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  280 RMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYlphDVVVMTVKLCMLFAVLLTVPLIHFPARKAVMMMF 359
Cdd:pfam01490 227 AMTKILLVAIIIVTVLYILIGLVGYLAFGDNVKGNILLNLPKS---DWLIDIANLLLVIHLLLSFPLQAFPIRQIVENLL 303
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  360 FS------NFPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLS----WKKF 429
Cdd:pfam01490 304 FRkgasgkHNPKSKLLRVVIRSGLVVITYLIAISVPFFGDLLSLVGATSCAPLSFILPPLFHLKLKKTKKKSleklWKPI 383
                         410       420
                  ....*....|....*....|..
gi 109083851  430 GAFVLLIFGILVGNFSLALIIF 451
Cdd:pfam01490 384 LDVICIVIGLLLMAYGVAGLIL 405
PTZ00206 PTZ00206
amino acid transporter; Provisional
50-451 3.07e-18

amino acid transporter; Provisional


Pssm-ID: 240313  Cd Length: 467  Bit Score: 85.69  E-value: 3.07e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  50 SVFNLMNAIMGSGILGLAFIMANTGILGFSFLLLTVALLASYSVHLLLSMCIQTAVTSYEDLGLFAFGLPGKVVVAGTII 129
Cdd:PTZ00206  65 SAFNIASSTVGAGIVGLPSAANSSGLVMAMIYLIIITAMTIFSIYALGVAADKTNIRTYEGVARVLLGPWGSYYVAATRA 144
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 130 IQNIGAMSSYLLIIKTEFPAAIAEFLTGDYSRYWYlDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVV 209
Cdd:PTZ00206 145 FHGFSACVAYVISVGDILSATLKGTNAPDFLKQKS-GNRLLTSLMWLCFMLPLVIPRHIDSLRYVSTIAVSFMVYLVIVI 223
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 210 IIKKWSIPCPLTLNYVEkcfqiSNATDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKRMQNVTNTAI 289
Cdd:PTZ00206 224 VVHSCMNGLPENIKNVS-----VGKDDNAEIILFNSGNRAIEGLGVFIFAYVFQITAYEVYMDMTNRSVGKFVLASTIAM 298
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 290 ALSFLIYFISALFGYLTFYDKVESELLKGYSKYLPHDVVV----MTVKLCMLFAVLltvpliHFPARKAVMMMFFSNF-P 364
Cdd:PTZ00206 299 GMCFTMYVLTAFFGYMDFGRNVTGSVLLMYDPVNEPAIMVgfvgVLVKLFVSYALL------GMACRNALYDVIGWDArK 372
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 365 FSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLklsREDFLSWKKFGAF------VLLIFG 438
Cdd:PTZ00206 373 VAFWKHCIAVVTLSVVMLLCGLFIPKINTVLGFAGSISGGLLGFILPALLFM---YSGGFTWQKVGPFyyistyVVLITG 449
                        410
                 ....*....|...
gi 109083851 439 ILVGNFSLALIIF 451
Cdd:PTZ00206 450 VIAIVFGTGATIW 462
SdaC COG0814
Amino acid permeases [Amino acid transport and metabolism]
50-451 4.14e-19

Amino acid permeases [Amino acid transport and metabolism]


Pssm-ID: 223884 [Multi-domain]  Cd Length: 415  Bit Score: 87.71  E-value: 4.14e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851  50 SVFNLMNAIMGSGILGLAFIMANTGILgFSFLLLTVALLASYSVHLLLSMCIQTA---VTSYEDLGLFAFGLPGKVVVAG 126
Cdd:COG0814   14 GVLILAGTAIGAGVLFLPVAFGGGGFW-PGLLLLIIAWPLTYLSLLLLLEALLSSpngKASITSLVEDYLGKKGGILIGL 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 127 TIIIQNIGAMSSYLLIIKTEFPAAIAEFLTGDYSRYWyldgqtLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFA 206
Cdd:COG0814   93 SYFFALYGLLVAYIVGIGNLLASFLGNQFGLNPLPRK------LGSLIFALVLAFLSWLGTLAVLKITSLLVFGKVIYLV 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 207 LVVIikkWSIPCPLTLNYVEKCFqisnatddckpKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKRMQNVTN 286
Cdd:COG0814  167 LLVV---YLIPHWNPANLFALPS-----------ASQSFWKYLLLAIPVFVFSFGFHGNIPSLVNYMRKNSKKAVRKAIL 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 287 TAIALSFLIYFISALFGYLTFYDKVESELLKGY----------SKYLPHDVVVMTVKLCMLFAVL---LTVPLIHFPARK 353
Cdd:COG0814  233 IGSLIALVLYILVGFFVFGCFGSLVFGNILAAKeqnisllsalAGVINSPILSIALNIFALFAIAtsfLGVYLGLFEGLA 312
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109083851 354 AVMMM--FFSNFPFSWIRHFLITLAL-NIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKFG 430
Cdd:COG0814  313 DLFKKsnSKPGRKKTGLLTFLPPLIFaLLYPWGFAIALGYAGGLIATIGAPIIPALLFIKPRKLIYKLPALKVYGGNFLL 392
                        410       420
                 ....*....|....*....|.
gi 109083851 431 AFVLLIFGILVGNFSLALIIF 451
Cdd:COG0814  393 LLLVLLFGILVILSPFLATFG 413
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH