NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|10835197|ref|NP_000857|]
View 

5-hydroxytryptamine receptor 1F [Homo sapiens]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7TM_GPCR_Srx super family cl18571
Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis ...
33-155 5.68e-05

Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srx is part of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


The actual alignment was detected with superfamily member pfam10328:

Pssm-ID: 255910  Cd Length: 274  Bit Score: 42.95  E-value: 5.68e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197    33 LALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVA---------VLVMPFSIVYIVRESWIMGQVVCDIWLsvd 103
Cdd:pfam10328   3 ISLFGIILNWLIFYIFLKLPSLKNSFGILCANKAISNAIICtiflfyvvpMTLLDLSFLPELLNSHIGGLILLILYE--- 79
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 10835197   104 itccTCSILHLSaIALDRYRAITDAVEYARKRTPKHAGIMITIVWIISVFIS 155
Cdd:pfam10328  80 ----ISPLTHLL-ISLNRFCAVFFPFKYKKIFSIKNTKIIITIIWIISIIIS 126
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
46-347 3.01e-56

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


:

Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 186.35  E-value: 3.01e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197    46 AAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDRYRAI 125
Cdd:pfam00001   1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197   126 TDAVEYARKRTPKHAGIMITIVWIISVFISMPPLF--WRHQGTSRDD-ECII----KHDHIVSTIYSTFGAFYIPLALIL 198
Cdd:pfam00001  81 VHPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLfsWLRTVEEGNVtTCLIdfpeESTLRSYTLLSTLLGFVLPLLVIL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197   199 ILYYKIYRaaktlyhkrqasriakeevngqvllesgekstksvstsyvlekslsdpstdfdKIHSTVRSLRSEfkheksw 278
Cdd:pfam00001 161 VCYTLILR-----------------------------------------------------TLRKRARSGASQ------- 180
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 10835197   279 RRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCDKC--KISEEMSNFLAWLGYLNSLINPLIY 347
Cdd:pfam00001 181 ARAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSiiRLLPTALLITLWLAYVNSCLNPIIY 251
 
Name Accession Description Interval E-value
7TM_GPCR_Srx pfam10328
Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis ...
33-155 5.68e-05

Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srx is part of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


Pssm-ID: 255910  Cd Length: 274  Bit Score: 42.95  E-value: 5.68e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197    33 LALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVA---------VLVMPFSIVYIVRESWIMGQVVCDIWLsvd 103
Cdd:pfam10328   3 ISLFGIILNWLIFYIFLKLPSLKNSFGILCANKAISNAIICtiflfyvvpMTLLDLSFLPELLNSHIGGLILLILYE--- 79
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 10835197   104 itccTCSILHLSaIALDRYRAITDAVEYARKRTPKHAGIMITIVWIISVFIS 155
Cdd:pfam10328  80 ----ISPLTHLL-ISLNRFCAVFFPFKYKKIFSIKNTKIIITIIWIISIIIS 126
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
46-347 3.01e-56

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 186.35  E-value: 3.01e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197    46 AAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDRYRAI 125
Cdd:pfam00001   1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197   126 TDAVEYARKRTPKHAGIMITIVWIISVFISMPPLF--WRHQGTSRDD-ECII----KHDHIVSTIYSTFGAFYIPLALIL 198
Cdd:pfam00001  81 VHPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLfsWLRTVEEGNVtTCLIdfpeESTLRSYTLLSTLLGFVLPLLVIL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197   199 ILYYKIYRaaktlyhkrqasriakeevngqvllesgekstksvstsyvlekslsdpstdfdKIHSTVRSLRSEfkheksw 278
Cdd:pfam00001 161 VCYTLILR-----------------------------------------------------TLRKRARSGASQ------- 180
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 10835197   279 RRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCDKC--KISEEMSNFLAWLGYLNSLINPLIY 347
Cdd:pfam00001 181 ARAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSiiRLLPTALLITLWLAYVNSCLNPIIY 251
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
32-222 2.88e-10

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 59.79  E-value: 2.88e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197   32 GLALMTTTINSL-----VIAAIIVTR-KLHHPANYLICSLAVTDfLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDIT 105
Cdd:PHA03087  42 ILIVVYSTIFFFglvgnIIVIYVLTKtKIKTPMDIYLLNLAVSD-LLFVMTLPFQIYYYILFQWSFGEFACKIVSGLYYI 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197  106 CCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAGIMITIVWIISVfISMPPLFWRHQgTSRDDECIIKHDH------- 178
Cdd:PHA03087 121 GFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISI-IETTPILFVYT-TKKDHETLICCMFynnktmn 198
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
gi 10835197  179 --IVSTIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAK 222
Cdd:PHA03087 199 wkLFINFEINIIGMLIPLTILLYCYSKILITLKGINKSKKNKKAIK 244
 
Name Accession Description Interval E-value
7TM_GPCR_Srx pfam10328
Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis ...
33-155 5.68e-05

Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srx is part of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


Pssm-ID: 255910  Cd Length: 274  Bit Score: 42.95  E-value: 5.68e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197    33 LALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVA---------VLVMPFSIVYIVRESWIMGQVVCDIWLsvd 103
Cdd:pfam10328   3 ISLFGIILNWLIFYIFLKLPSLKNSFGILCANKAISNAIICtiflfyvvpMTLLDLSFLPELLNSHIGGLILLILYE--- 79
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 10835197   104 itccTCSILHLSaIALDRYRAITDAVEYARKRTPKHAGIMITIVWIISVFIS 155
Cdd:pfam10328  80 ----ISPLTHLL-ISLNRFCAVFFPFKYKKIFSIKNTKIIITIIWIISIIIS 126
7TM_GPCR_Srsx pfam10320
Serpentine type 7TM GPCR chemoreceptor Srsx; Chemoreception is mediated in Caenorhabditis ...
41-222 8.56e-04

Serpentine type 7TM GPCR chemoreceptor Srsx; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srsx is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


Pssm-ID: 255903  Cd Length: 257  Bit Score: 39.11  E-value: 8.56e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197    41 NSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESwiMGQVVCDIWLSV-DITCCTCSILHLSaIAL 119
Cdd:pfam10320   8 NVLMIHLTFRKKKLRSKCSILICVQCIAHLICLCGEIVFVVLLFTGTQ--LTRNECFWMISFyIFGQTAQGPLMLM-IGI 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197   120 DRYRAITDAVEYARKRTPKHAGIMITIVWIISVFIsmppLFWRHQgtSRDDECIIK------HDHIVSTIYSTFGAF-YI 192
Cdd:pfam10320  85 DRLIAVKFPIFYRLLSSSKYLFIQLIFPVIYSSFI----TVYGFL--QRDDETIIVcapplaLPGTAFTIFTLSSLFiNV 158
                         170       180       190
                  ....*....|....*....|....*....|
gi 10835197   193 plaLILILYYKIYRAAKTlYHKRQASRIAK 222
Cdd:pfam10320 159 ---IVLIVYIILIIIFKN-KKQSQNSDSKK 184
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
46-347 3.01e-56

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 186.35  E-value: 3.01e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197    46 AAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDRYRAI 125
Cdd:pfam00001   1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197   126 TDAVEYARKRTPKHAGIMITIVWIISVFISMPPLF--WRHQGTSRDD-ECII----KHDHIVSTIYSTFGAFYIPLALIL 198
Cdd:pfam00001  81 VHPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLfsWLRTVEEGNVtTCLIdfpeESTLRSYTLLSTLLGFVLPLLVIL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197   199 ILYYKIYRaaktlyhkrqasriakeevngqvllesgekstksvstsyvlekslsdpstdfdKIHSTVRSLRSEfkheksw 278
Cdd:pfam00001 161 VCYTLILR-----------------------------------------------------TLRKRARSGASQ------- 180
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 10835197   279 RRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCDKC--KISEEMSNFLAWLGYLNSLINPLIY 347
Cdd:pfam00001 181 ARAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSiiRLLPTALLITLWLAYVNSCLNPIIY 251
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
32-222 2.88e-10

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 59.79  E-value: 2.88e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197   32 GLALMTTTINSL-----VIAAIIVTR-KLHHPANYLICSLAVTDfLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDIT 105
Cdd:PHA03087  42 ILIVVYSTIFFFglvgnIIVIYVLTKtKIKTPMDIYLLNLAVSD-LLFVMTLPFQIYYYILFQWSFGEFACKIVSGLYYI 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197  106 CCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAGIMITIVWIISVfISMPPLFWRHQgTSRDDECIIKHDH------- 178
Cdd:PHA03087 121 GFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISI-IETTPILFVYT-TKKDHETLICCMFynnktmn 198
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
gi 10835197  179 --IVSTIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAK 222
Cdd:PHA03087 199 wkLFINFEINIIGMLIPLTILLYCYSKILITLKGINKSKKNKKAIK 244
PHA02834 PHA02834
chemokine receptor-like protein; Provisional
41-220 6.91e-06

chemokine receptor-like protein; Provisional


Pssm-ID: 165177 [Multi-domain]  Cd Length: 323  Bit Score: 46.05  E-value: 6.91e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197   41 NSLVIAAIIVTRKLHHPANYLIcSLAVTDFLVaVLVMPFsIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD 120
Cdd:PHA02834  46 NVLVIAVLIVKRFMFVVDVYLF-NIAMSDLML-VFSFPF-IIHNDLNEWIFGEFMCKLVLGVYFVGFFSNMFFVTLISID 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197  121 RYRAITDAVEYARKRTpkHAGIMITI-VWIISVFISMPPLFWRH-QGTSRDDECIIKHDHIVSTIYSTFG------AFYI 192
Cdd:PHA02834 123 RYILVVNATKIKNKSI--SLSVLLSVaAWVCSVILSMPAMVLYYvDNTDNLKQCIFNDYHENFSWSAFFNfeinifGIVI 200
                        170       180
                 ....*....|....*....|....*...
gi 10835197  193 PLALILILYYKIYRAAKTLYHKRQASRI 220
Cdd:PHA02834 201 PLIILIYCYSKILYTLKNCKNKNKTRSI 228
PHA02638 PHA02638
CC chemokine receptor-like protein; Provisional
40-160 7.04e-05

CC chemokine receptor-like protein; Provisional


Pssm-ID: 165021 [Multi-domain]  Cd Length: 417  Bit Score: 43.08  E-value: 7.04e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197   40 INSLVIAAIIVTRKLHHPANYLICSLAVTDfLVAVLVMPFsIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIAL 119
Cdd:PHA02638 114 FGNAAIIMILFCKKIKTITDIYIFNLAISD-LIFVIDFPF-IIYNEFDQWIFGDFMCKVISASYYIGFFSNMFLITLMSI 191
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 10835197  120 DRYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLF 160
Cdd:PHA02638 192 DRYFAILYPISFQKYRTFNIGIILCIISWILSLIITSPAYF 232
PHA03235 PHA03235
DNA packaging protein UL33; Provisional
39-221 1.43e-04

DNA packaging protein UL33; Provisional


Pssm-ID: 223017 [Multi-domain]  Cd Length: 409  Bit Score: 42.11  E-value: 1.43e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197   39 TINSLVIAAIIVTRKLH---HPANYLIcSLAVTDFLVaVLVMPFsivYIVRESWIMGQVV--CDIWLSVDITCCTCSILH 113
Cdd:PHA03235  48 PLNLIVLVTQLLANRVHgfsTPTLYMT-NLYLANLLT-VFVLPF---IMLSNQGLLSGSVagCKFASLLYYASCTVGFAT 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835197  114 LSAIALDRYRAITDAVeYARKRTPKHAGIMITIVWIISVFISMP-PLF---WRHQG---TSRDDE-CII--KHDHiVSTI 183
Cdd:PHA03235 123 VALIAADRYRVIHQRT-RARSSAYRSTYKILGLTWFASLICSGPaPVYttvVAHDDvdpEAPGYEtCVIyfRADQ-VKTV 200
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....
gi 10835197  184 YSTFGAFY------IPLALILILYYKIYRAAKTLYHKRQASRIA 221
Cdd:PHA03235 201 LSTFKVLLtlvwgiAPVVMMTWFYTFFYRTLKRASYKKRSRTLT 244
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH