NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|10835099|ref|NP_066580|]
View 

solute carrier organic anion transporter family member 1A2 [Homo sapiens]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
KAZAL_SLC21 cd01330
The kazal-type serine protease inhibitor domain has been detected in an extracellular loop ...
435-488 1.47e-22

The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The KAZAL_SLC21 domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.


:

Pssm-ID: 238650  Cd Length: 54  Bit Score: 91.98  E-value: 1.47e-22
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....
gi 10835099 435 IFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQ 488
Cdd:cd01330   1 LTSSCNSNCSCSESAYSPVCGENGITYFSPCHAGCTNSTGSGGSKIYTNCSCVG 54
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
23-381 4.15e-10

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


:

Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 60.41  E-value: 4.15e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099  23 LLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFL 102
Cdd:cd06174   1 LLLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099 103 KSLPHflmnqyeyestvsvsgnlssnsflcmengtqilrptqdpsectkevkslMWVYVLVGNIVRGMGETPILPLGISY 182
Cdd:cd06174  81 LAFAS-------------------------------------------------SLWLLLVGRFLLGLGGGALYPAAAAL 111
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099 183 IEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYvdtgfvntddliitptdtrwvgAWWFGFLICAGVNVLTAIP 262
Cdd:cd06174 112 IAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESL----------------------GWRWLFLILAILGLLLALL 169
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099 263 FFFLPntlpkegletnadiiknenedkqkeevkkekygitkdflpfmkslscnPIYMLFILVSVIQFNAFVNMISFMPKY 342
Cdd:cd06174 170 LLFLL------------------------------------------------RLLLLLALAFFLLSFGYYGLLTYLPLY 201
                       330       340       350
                ....*....|....*....|....*....|....*....
gi 10835099 343 LEQQYGISSSDAIFLMGIYNLPPIcIGYIIGGLIMKKFK 381
Cdd:cd06174 202 LQEVLGLSAAEAGLLLSLFGLGGI-LGALLGGLLSDRLG 239
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
1-625 0e+00

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


:

Pssm-ID: 233136 [Multi-domain]  Cd Length: 633  Bit Score: 920.66  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099     1 MGETEKRIETHRI--------RCL----SKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIG 68
Cdd:TIGR00805   1 MGELEKDGATQESstglkprpRCLqslfSKIKVFSLLLTCAQLQGLLYNGLVNSSLTTIERRFKLSTSSSGLINGSYEIG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099    69 NLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVSVSGNLSS-NSFLCMENGTQILRPTQDPS 147
Cdd:TIGR00805  81 NLLLIIFVSYFGTKLHRPIVIGIGCAIMGLGSFLLSLPHFLSGRYSYSTTVSSTGNLSSaNSFLCMENLTQALRPTQCPS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   148 ECTKEVK-SLMWVYVLVGNIVRGMGETPILPLGISYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGF 226
Cdd:TIGR00805 161 ECQKQHKeSLMWLLFLVSQLLRGIGATPIFPLGISYIDDFAKSKNSPLYIGILESIAVFGPAFGYLLGSFCLQIYVDTGS 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   227 VNTDDLIITPTDTRWVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFL 306
Cdd:TIGR00805 241 VNTEDVILTPTDPRWIGAWWIGFLICGGVALLTSIPLFFFPKALPKEGKRVNVDVHETEKLEKSEDESRKKNSDITKDFP 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   307 PFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGIYNLPPICIGYIIGGLIMKKFKITVKQ 386
Cdd:TIGR00805 321 KIIKRLLCNPIYMLVILAQVIDSLAFNGYITFLPKYLENQYGISSAEANFLIGVVNVPAAGLGYLIGGFIMKKFKLNVKK 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   387 AAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINTsyEGIPQDLYVENDIfaDCNVDCNCPSKIWDPVCGNNGLSYLSACL 466
Cdd:TIGR00805 401 AAYFAICLSTLSYLLCSPLFLIGCESAPVAGVNN--PSTDQSIYVENPT--DCNRQCSCDSSFFDPVCGDNGLAYLSPCH 476
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   467 AGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDkgPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSEEKSL 546
Cdd:TIGR00805 477 AGCSMSVGTGSNMVYTNCSCVQTPGNSSAKKGLCN--PSCATSLLYFLILFIPLSFIAFITAVPLYMVLLRVVNPEERSL 554
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 10835099   547 GVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYIYLGLPAALRGSSFVPALIILILLRK 625
Cdd:TIGR00805 555 AIGLQWLCMRVFGTIPAPILFGLLIDVSCLHWQTLCCGARGACRMYDNDNLRNIYLGLTIALRGSGLLLLFFILILMKK 633
 
Name Accession Description Interval E-value
KAZAL_SLC21 cd01330
The kazal-type serine protease inhibitor domain has been detected in an extracellular loop ...
435-488 1.47e-22

The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The KAZAL_SLC21 domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.


Pssm-ID: 238650  Cd Length: 54  Bit Score: 91.98  E-value: 1.47e-22
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....
gi 10835099 435 IFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQ 488
Cdd:cd01330   1 LTSSCNSNCSCSESAYSPVCGENGITYFSPCHAGCTNSTGSGGSKIYTNCSCVG 54
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
23-381 4.15e-10

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 60.41  E-value: 4.15e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099  23 LLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFL 102
Cdd:cd06174   1 LLLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099 103 KSLPHflmnqyeyestvsvsgnlssnsflcmengtqilrptqdpsectkevkslMWVYVLVGNIVRGMGETPILPLGISY 182
Cdd:cd06174  81 LAFAS-------------------------------------------------SLWLLLVGRFLLGLGGGALYPAAAAL 111
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099 183 IEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYvdtgfvntddliitptdtrwvgAWWFGFLICAGVNVLTAIP 262
Cdd:cd06174 112 IAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESL----------------------GWRWLFLILAILGLLLALL 169
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099 263 FFFLPntlpkegletnadiiknenedkqkeevkkekygitkdflpfmkslscnPIYMLFILVSVIQFNAFVNMISFMPKY 342
Cdd:cd06174 170 LLFLL------------------------------------------------RLLLLLALAFFLLSFGYYGLLTYLPLY 201
                       330       340       350
                ....*....|....*....|....*....|....*....
gi 10835099 343 LEQQYGISSSDAIFLMGIYNLPPIcIGYIIGGLIMKKFK 381
Cdd:cd06174 202 LQEVLGLSAAEAGLLLSLFGLGGI-LGALLGGLLSDRLG 239
Kazal_2 pfam07648
Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. ...
445-486 3.62e-09

Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. However, kazal-like domains are also seen in the extracellular part of agrins, which are not known to be protease inhibitors. Kazal domains often occur in tandem arrays. Small alpha+beta fold containing three disulphides.


Pssm-ID: 254329  Cd Length: 41  Bit Score: 53.48  E-value: 3.62e-09
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 10835099   445 CPsKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSC 486
Cdd:pfam07648   1 CP-RENDPVCGSDGKTYSNECALCCASCLLGEKIKVKYEGSC 41
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
1-625 0e+00

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 233136 [Multi-domain]  Cd Length: 633  Bit Score: 920.66  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099     1 MGETEKRIETHRI--------RCL----SKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIG 68
Cdd:TIGR00805   1 MGELEKDGATQESstglkprpRCLqslfSKIKVFSLLLTCAQLQGLLYNGLVNSSLTTIERRFKLSTSSSGLINGSYEIG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099    69 NLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVSVSGNLSS-NSFLCMENGTQILRPTQDPS 147
Cdd:TIGR00805  81 NLLLIIFVSYFGTKLHRPIVIGIGCAIMGLGSFLLSLPHFLSGRYSYSTTVSSTGNLSSaNSFLCMENLTQALRPTQCPS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   148 ECTKEVK-SLMWVYVLVGNIVRGMGETPILPLGISYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGF 226
Cdd:TIGR00805 161 ECQKQHKeSLMWLLFLVSQLLRGIGATPIFPLGISYIDDFAKSKNSPLYIGILESIAVFGPAFGYLLGSFCLQIYVDTGS 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   227 VNTDDLIITPTDTRWVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFL 306
Cdd:TIGR00805 241 VNTEDVILTPTDPRWIGAWWIGFLICGGVALLTSIPLFFFPKALPKEGKRVNVDVHETEKLEKSEDESRKKNSDITKDFP 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   307 PFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGIYNLPPICIGYIIGGLIMKKFKITVKQ 386
Cdd:TIGR00805 321 KIIKRLLCNPIYMLVILAQVIDSLAFNGYITFLPKYLENQYGISSAEANFLIGVVNVPAAGLGYLIGGFIMKKFKLNVKK 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   387 AAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINTsyEGIPQDLYVENDIfaDCNVDCNCPSKIWDPVCGNNGLSYLSACL 466
Cdd:TIGR00805 401 AAYFAICLSTLSYLLCSPLFLIGCESAPVAGVNN--PSTDQSIYVENPT--DCNRQCSCDSSFFDPVCGDNGLAYLSPCH 476
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   467 AGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDkgPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSEEKSL 546
Cdd:TIGR00805 477 AGCSMSVGTGSNMVYTNCSCVQTPGNSSAKKGLCN--PSCATSLLYFLILFIPLSFIAFITAVPLYMVLLRVVNPEERSL 554
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 10835099   547 GVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYIYLGLPAALRGSSFVPALIILILLRK 625
Cdd:TIGR00805 555 AIGLQWLCMRVFGTIPAPILFGLLIDVSCLHWQTLCCGARGACRMYDNDNLRNIYLGLTIALRGSGLLLLFFILILMKK 633
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
19-598 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 251753 [Multi-domain]  Cd Length: 583  Bit Score: 759.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099    19 LKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGL 98
Cdd:pfam03137   1 IKVFLLLLGLAALLQLLVNAYFKSSITTIEKRFKISSSHSGIISSSYDIGNLLLIIFVSYFGSKGHRPRWIGIGGLLMAL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099    99 GCFLKSLPHFLMNQYEYESTVSVSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPL 178
Cdd:pfam03137  81 GSLLTALPHFLSGPYSYEQTNLTGSNESSNSTLCTHGGALIPSPCQSEGSCHKESTSLMWLLLFVGQLLRGIGATPIFTL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   179 GISYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLICAGVNVL 258
Cdd:pfam03137 161 GISYIDDNVKSKNSPLYLGILFTMAMFGPAIGFLLGSFCLRLYVDFGRVPTEDVIITPTDPRWVGAWWLGFLVCGGLALL 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   259 TAIPFFFLPNTLPKE-GLETNADIIKNENEDKQKEEVKKEKYGI-----TKDFLPFMKSLSCNPIYMLFILVSVIQFNAF 332
Cdd:pfam03137 241 SAIPFFFFPKTLPKAqGRLESLDLSRPKAKDETRKQAEEPKSGKsapdfLKDFPKTLKRLLTNPTFMLVVLAQVFESSVI 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   333 VNMISFMPKYLEQQYGISSSDAIFLMGIYNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCEN 412
Cdd:pfam03137 321 AGYSTFLPKYLETQYGLSASYANFLIGVVNLPAAAVGILLGGLIIKKFKLTARGMAKFAIFVILVSLAFYLPYFFIGCEN 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   413 SSVVGINTSYEGiPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGN 492
Cdd:pfam03137 401 SPVAGVTPSYEN-SPSDSHHLEPLSSCNEDCSCDTSFFPPVCGDNGLTYISACGAGCSTSSGTGCKTECSTNSNNQSSGN 479
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   493 SSAVLGLCDkgPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSEEKSLGVGLHTFCTRVFAGIPAPIYFGALMD 572
Cdd:pfam03137 480 SHAAKGYCP--SDCCTQFLYFLILMAILSFIGALSAIPLYMIVLRCVPPEEKSLALGVQWLLIRLLGFIPAPIIFGALID 557
                         570       580
                  ....*....|....*....|....*.
gi 10835099   573 STCLHWGTLKCGESGACRIYDSTTFR 598
Cdd:pfam03137 558 STCLKWGTSCCGKRGACRLYDNDSLR 583
 
Name Accession Description Interval E-value
KAZAL_SLC21 cd01330
The kazal-type serine protease inhibitor domain has been detected in an extracellular loop ...
435-488 1.47e-22

The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The KAZAL_SLC21 domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.


Pssm-ID: 238650  Cd Length: 54  Bit Score: 91.98  E-value: 1.47e-22
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....
gi 10835099 435 IFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQ 488
Cdd:cd01330   1 LTSSCNSNCSCSESAYSPVCGENGITYFSPCHAGCTNSTGSGGSKIYTNCSCVG 54
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
23-381 4.15e-10

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 60.41  E-value: 4.15e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099  23 LLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFL 102
Cdd:cd06174   1 LLLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099 103 KSLPHflmnqyeyestvsvsgnlssnsflcmengtqilrptqdpsectkevkslMWVYVLVGNIVRGMGETPILPLGISY 182
Cdd:cd06174  81 LAFAS-------------------------------------------------SLWLLLVGRFLLGLGGGALYPAAAAL 111
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099 183 IEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYvdtgfvntddliitptdtrwvgAWWFGFLICAGVNVLTAIP 262
Cdd:cd06174 112 IAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESL----------------------GWRWLFLILAILGLLLALL 169
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099 263 FFFLPntlpkegletnadiiknenedkqkeevkkekygitkdflpfmkslscnPIYMLFILVSVIQFNAFVNMISFMPKY 342
Cdd:cd06174 170 LLFLL------------------------------------------------RLLLLLALAFFLLSFGYYGLLTYLPLY 201
                       330       340       350
                ....*....|....*....|....*....|....*....
gi 10835099 343 LEQQYGISSSDAIFLMGIYNLPPIcIGYIIGGLIMKKFK 381
Cdd:cd06174 202 LQEVLGLSAAEAGLLLSLFGLGGI-LGALLGGLLSDRLG 239
Kazal_2 pfam07648
Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. ...
445-486 3.62e-09

Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. However, kazal-like domains are also seen in the extracellular part of agrins, which are not known to be protease inhibitors. Kazal domains often occur in tandem arrays. Small alpha+beta fold containing three disulphides.


Pssm-ID: 254329  Cd Length: 41  Bit Score: 53.48  E-value: 3.62e-09
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 10835099   445 CPsKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSC 486
Cdd:pfam07648   1 CP-RENDPVCGSDGKTYSNECALCCASCLLGEKIKVKYEGSC 41
KAZAL_FS cd00104
Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit ...
445-486 1.53e-07

Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit serine proteases, such as, trypsin, chyomotrypsin, avian ovomucoids, and elastases. The inhibitory domain has one reactive site peptide bond, which serves the cognate enzyme as substrate. The reactive site peptide bond is a combining loop which has an identical conformation in all Kazal inhibitors and in all enzyme/inhibitor complexes. These Kazal domains (small hydrophobic core of alpha/beta structure with 3 to 4 disulfide bonds) often occur in tandem arrays. Similar domains are also present in follistatin (FS) and follistatin-like family members, which play an important role in tissue specific regulation. The FS domain consists of an N-terminal beta hairpin (FOLN/EGF-like domain) and a Kazal-like domain and has five disulfide bonds. Although the Kazal-like FS substructure is similar to Kazal proteinase inhibitors, no FS domain has yet been shown to be a proteinase inhibitor. Follistatin-like family members include SPARC, also known as, BM-40 or osteonectin, the Gallus gallus Flik protein, as well as, agrin which has a long array of FS domains. The kazal-type inhibitor domain has also been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The distant homolog, Ascidian trypsin inhibitor, is included in this CD.


Pssm-ID: 238052  Cd Length: 41  Bit Score: 48.81  E-value: 1.53e-07
                        10        20        30        40
                ....*....|....*....|....*....|....*....|..
gi 10835099 445 CPsKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSC 486
Cdd:cd00104   1 CP-KEYDPVCGSDGKTYSNECHLGCAACRSGRSITVAHNGPC 41
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
1-625 0e+00

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 233136 [Multi-domain]  Cd Length: 633  Bit Score: 920.66  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099     1 MGETEKRIETHRI--------RCL----SKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIG 68
Cdd:TIGR00805   1 MGELEKDGATQESstglkprpRCLqslfSKIKVFSLLLTCAQLQGLLYNGLVNSSLTTIERRFKLSTSSSGLINGSYEIG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099    69 NLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVSVSGNLSS-NSFLCMENGTQILRPTQDPS 147
Cdd:TIGR00805  81 NLLLIIFVSYFGTKLHRPIVIGIGCAIMGLGSFLLSLPHFLSGRYSYSTTVSSTGNLSSaNSFLCMENLTQALRPTQCPS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   148 ECTKEVK-SLMWVYVLVGNIVRGMGETPILPLGISYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGF 226
Cdd:TIGR00805 161 ECQKQHKeSLMWLLFLVSQLLRGIGATPIFPLGISYIDDFAKSKNSPLYIGILESIAVFGPAFGYLLGSFCLQIYVDTGS 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   227 VNTDDLIITPTDTRWVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFL 306
Cdd:TIGR00805 241 VNTEDVILTPTDPRWIGAWWIGFLICGGVALLTSIPLFFFPKALPKEGKRVNVDVHETEKLEKSEDESRKKNSDITKDFP 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   307 PFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGIYNLPPICIGYIIGGLIMKKFKITVKQ 386
Cdd:TIGR00805 321 KIIKRLLCNPIYMLVILAQVIDSLAFNGYITFLPKYLENQYGISSAEANFLIGVVNVPAAGLGYLIGGFIMKKFKLNVKK 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   387 AAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINTsyEGIPQDLYVENDIfaDCNVDCNCPSKIWDPVCGNNGLSYLSACL 466
Cdd:TIGR00805 401 AAYFAICLSTLSYLLCSPLFLIGCESAPVAGVNN--PSTDQSIYVENPT--DCNRQCSCDSSFFDPVCGDNGLAYLSPCH 476
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   467 AGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDkgPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSEEKSL 546
Cdd:TIGR00805 477 AGCSMSVGTGSNMVYTNCSCVQTPGNSSAKKGLCN--PSCATSLLYFLILFIPLSFIAFITAVPLYMVLLRVVNPEERSL 554
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 10835099   547 GVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYIYLGLPAALRGSSFVPALIILILLRK 625
Cdd:TIGR00805 555 AIGLQWLCMRVFGTIPAPILFGLLIDVSCLHWQTLCCGARGACRMYDNDNLRNIYLGLTIALRGSGLLLLFFILILMKK 633
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
19-598 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 251753 [Multi-domain]  Cd Length: 583  Bit Score: 759.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099    19 LKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGL 98
Cdd:pfam03137   1 IKVFLLLLGLAALLQLLVNAYFKSSITTIEKRFKISSSHSGIISSSYDIGNLLLIIFVSYFGSKGHRPRWIGIGGLLMAL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099    99 GCFLKSLPHFLMNQYEYESTVSVSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPL 178
Cdd:pfam03137  81 GSLLTALPHFLSGPYSYEQTNLTGSNESSNSTLCTHGGALIPSPCQSEGSCHKESTSLMWLLLFVGQLLRGIGATPIFTL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   179 GISYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLICAGVNVL 258
Cdd:pfam03137 161 GISYIDDNVKSKNSPLYLGILFTMAMFGPAIGFLLGSFCLRLYVDFGRVPTEDVIITPTDPRWVGAWWLGFLVCGGLALL 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   259 TAIPFFFLPNTLPKE-GLETNADIIKNENEDKQKEEVKKEKYGI-----TKDFLPFMKSLSCNPIYMLFILVSVIQFNAF 332
Cdd:pfam03137 241 SAIPFFFFPKTLPKAqGRLESLDLSRPKAKDETRKQAEEPKSGKsapdfLKDFPKTLKRLLTNPTFMLVVLAQVFESSVI 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   333 VNMISFMPKYLEQQYGISSSDAIFLMGIYNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCEN 412
Cdd:pfam03137 321 AGYSTFLPKYLETQYGLSASYANFLIGVVNLPAAAVGILLGGLIIKKFKLTARGMAKFAIFVILVSLAFYLPYFFIGCEN 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   413 SSVVGINTSYEGiPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGN 492
Cdd:pfam03137 401 SPVAGVTPSYEN-SPSDSHHLEPLSSCNEDCSCDTSFFPPVCGDNGLTYISACGAGCSTSSGTGCKTECSTNSNNQSSGN 479
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   493 SSAVLGLCDkgPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSEEKSLGVGLHTFCTRVFAGIPAPIYFGALMD 572
Cdd:pfam03137 480 SHAAKGYCP--SDCCTQFLYFLILMAILSFIGALSAIPLYMIVLRCVPPEEKSLALGVQWLLIRLLGFIPAPIIFGALID 557
                         570       580
                  ....*....|....*....|....*.
gi 10835099   573 STCLHWGTLKCGESGACRIYDSTTFR 598
Cdd:pfam03137 558 STCLKWGTSCCGKRGACRLYDNDSLR 583
MFS_1 pfam07690
Major Facilitator Superfamily;
28-409 4.10e-11

Major Facilitator Superfamily;


Pssm-ID: 254360 [Multi-domain]  Cd Length: 346  Bit Score: 63.59  E-value: 4.10e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099    28 CAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLkslph 107
Cdd:pfam07690   4 AAFLAGLGRSLLGPALPLYLAEDLGISPTEIGLLLTAFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLL----- 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   108 fLMnqyeyestvsvsgnLSSNSFLcmengtqilrptqdpsectkevkslmwvyVLVGNIVRGMGETPILPLGISYIEDFA 187
Cdd:pfam07690  79 -LL--------------FASSLWL-----------------------------LLVLRVLQGLGGGALFPAAAALIADWF 114
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   188 KFENSPLYIGLVETGAIIGPLIGLLLASFcanvyvdtgfvntddlIITPTDTRWVgawwfgFLICAGVNVLTAI-PFFFL 266
Cdd:pfam07690 115 PPEERGRALGLLSAGFGLGAALGPLLGGL----------------LASLFGWRAA------FLILAILALLAAVlAALLL 172
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10835099   267 PNTLPKEGLETNADiiknenedkqkeevkkekyGITKDFLPFMKSLSCNPIyMLFILVSVIQFNAFVNMISFMPKYLEqQ 346
Cdd:pfam07690 173 PRPPPESKRPKPAE-------------------EAPAPLLPAWKLLLRDPV-LWLLLALLLFGFAFFALLTYLPLYQE-V 231
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 10835099   347 YGISSSDAIFLMGIYNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMT 409
Cdd:pfam07690 232 LGLSALLAGLLLGLAGLLGAIGRLLLGRLSDRLGRRRRLLLALLLLILAALGLALLSLTESSL 294
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH