NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|28558074|sp|Q9ULK4.2|MED23_HUMAN]
View 

RecName: Full=Mediator of RNA polymerase II transcription subunit 23; AltName: Full=Activator-recruited cofactor 130 kDa component; Short=ARC130; AltName: Full=Cofactor required for Sp1 transcriptional activation subunit 3; Short=CRSP complex subunit 3; AltName: Full=Mediator complex subunit 23; AltName: Full=Protein sur-2 homolog; Short=hSur-2; AltName: Full=Transcriptional coactivator CRSP130; AltName: Full=Vitamin D3 receptor-interacting protein complex 130 kDa component; Short=DRIP130

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Med23 pfam11573
Mediator complex subunit 23; Med23 is one of the subunits of the Tail portion of the Mediator ...
1-1307 0e+00

Mediator complex subunit 23; Med23 is one of the subunits of the Tail portion of the Mediator complex that regulates RNA polymerase II activity. Med23 is required for heat-shock-specific gene expression, and has been shown to mediate transcriptional activation of E1A in mice.


:

Pssm-ID: 288430  Cd Length: 1300  Bit Score: 2196.76  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074      1 METQLQSIFEEVVKTEVIEEAFPGMFMDTPEDEKTKLISCLGAFRQFWGGLSQESHEQCIQWIVKFIHGQHSPKRISFLY 80
Cdd:pfam11573    1 EENQIKSIVNEILKVEAIEEAFSPFTSNLPDNEKEKTAILRKEFNNMMSKMSEEEKESAVRELLKLVHHVAEKNRLDFVF 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074     81 DCLAMAVETGLLPPRLVCESLINSDTLEWERTQLWALTFKLVRKIIGGVDYKGVRDLLKVILEKILTIPNTVSSAVVQQL 160
Cdd:pfam11573   81 QLLEYAVQKGVISARLVCEGLIMTEKLVYCNRLFWIECFKLIRKIIGGVDYKGVREILKYCLEKARRLPYRLSPEKVPQL 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    161 LAAREVIAYILERNACLLPAYFAVTEIRKLYPEGKLpHWLLGNLVSDFVDTFRPTARINSICGRCSLLPVVNNSG---AI 237
Cdd:pfam11573  161 RALENVIEYIFDRNACLLPAYFIVNEIMKGYPQNKM-HWRLAELLSNFVESFRPIAQMVSIIGRSFMLPVVEHSGyadHL 239
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    238 CNSWKLDPATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSRDMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSET 317
Cdd:pfam11573  240 TSPWKLDPNTLKFQLKGNLPYRPELLEPQTYLLRYVLEQPYSRDMVCSMLGLQKQQKQRCKALEEQLVELMICAMERSEN 319
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    318 EEKFDDGGTSQLLWQHLSSQLIFFVLFQFASFPHMVLSLHQKLAGRGLIKGRDHLMWVLLQFISGSIQKNALADFLPVMK 397
Cdd:pfam11573  320 ESLPEGEPIPHWQWLHLSSQLIYFVLFQFASFPHIVKALHEKLAGRDLRRGRDHLMWVLLQFISGSIQKNPLSDFLPILK 399
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    398 LFDLLYPEKEYIPVPDINKPQSTHAFAMTCIWIHLNRKAQNDNSKLQIPIPHSLRLHHEFLQQ-SLRNKSLQM---NDYK 473
Cdd:pfam11573  400 LYDLLYPEKEPLPVPDYNPALCTHQMAAACIWIHLLKKAQDENSNIQRPIPDALKSHHEFLQHlVLNNNSKNLamgSDYR 479
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    474 IALLCNAYSTNSECFTLPMGALVETIYGNGIMRIPLPgtncmASGSITPLPMNLLDSLTVHAKMSLIHSIATRVIKLAHA 553
Cdd:pfam11573  480 IALLCNAYSTNTEYFSRPMPALVETILGNSKSPSPGL-----APGPTVPLSMEFLDSLTVHSKMSLIHSIVTHVIKFAQT 554
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    554 KSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTLAAV 633
Cdd:pfam11573  555 KSPVPLAPALVETYSRLLVYTEIESLGIKGFISQLLPTVFKSHAWGILYTLLEMFSYRMHHIQPHYRVQLLSHLHSLANV 634
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    634 AQTNQNQLHLCVESTALRLITALGSSEVQPQFTRFLSDPKT--VLSAESEELNRALILTLARATHVTdfftGSDSIQGTW 711
Cdd:pfam11573  635 PQTNQTQLHLCVESTALRLITGLGSSEVQPQLSRFLSEPKTfvLVSAESEELNRALILTLARSMHIT----GTGSDSGSW 710
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    712 CKDILQTIMSFTPHNWASHTLSCFPGPLQAFFKQNNVPQESRFNLKKNVEEEYRKWKSMSNENDIITHFSMQGSPPLFLC 791
Cdd:pfam11573  711 CKDLLETIMQNTPHSWPEHTLQCFPPWLLEFFKQNDVPKENKQQLKKAVEEEYRKWASMTNENDIIAHFSVPGTPPLFLC 790
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    792 LLWKMLLETDHINQIGYRVLERIGARALVAHVRTFADFLVYEFSTSAGGQQLNKCIEILNDMVWKYNIVTLDRLILCLAM 871
Cdd:pfam11573  791 LLWKMILETDRISPIAYKILERIGARALSAHLRKFCDYLVFEVSNSCGGQHVNKCVDAINDMIWKYNIVTIDRLVLCLAL 870
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    872 RSHEGNEAQVCYFIIQLLLLKPNDFRNRVSDFVKENSPEHWLQNDWHTKHMNYHKKYPEKLYFEGLAEQVDPPvqiQSPY 951
Cdd:pfam11573  871 RTLEGNEAQVCFFIIQLLLLKTPEFRNRVQEFVKENSPEHWKQSNWHEKHLAFHRKFPEKFAPEGVLESGDSS---SYPS 947
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    952 LPIYFGNVCLRFLPVFDIVIHRFLELLPVSKSLETLLDHLGGLYKFHDRPVTYLYNTLHYYEMHLRDRAFLKRKLVHAII 1031
Cdd:pfam11573  948 LPTYFGNVCLRFLPVLDIVVHRYLELPQVSKSLETLLEHLGCLYKFHDRPVTYLYNTLHYYERKLRDRPDLKRKLVSAIL 1027
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074   1032 GSLKDNRPQGWCLSDTYLKCAMNAREENPWVPDDTYYCRLIGRLVDTMAGKSpgPFPNCDWRFNEFPNPAAHALHVTCVE 1111
Cdd:pfam11573 1028 GSLKECRPPGWALSEAYQKYHQKSSDEQLWQPELDYYMELIDRLVDTLDGKS--PFPATDWRFNEFPNPGAHALYVTCVE 1105
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074   1112 LMALAVSGKEVGNALLNVVLKSQPLVPRENITAWMNAIGLIITALPEPYWIVLHDRIVSVISSPSLTSETEWvGYPFRLF 1191
Cdd:pfam11573 1106 LMALPVSPETVANALIDVVQKGYHVIPSNEIHLWINAIGLILTALPEPYWSVLHDRLVEVLSSPELTNWTYR-NSPFELF 1184
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074   1192 DFTACHQSYSEMSCSYTLALAHAVWHHSSIGQLSLIPKFLTEVLLPIVKTEFQLLYVYHLVGPFLQRFQQERTRCMIEIG 1271
Cdd:pfam11573 1185 NFDNYHESLLENRYSYILALAHSVWHHAGIGQLNTFPQFVKEKLLPHVKTEEQLLYLCHLVGPFLRRFNSERPRCVLDIT 1264
                         1290      1300      1310
                   ....*....|....*....|....*....|....*.
gi 28558074   1272 VAFYDMLLNVDQCSTHLNYMDPICDFLYHMKYMFTG 1307
Cdd:pfam11573 1265 KLLYELLEQVDKHGVELVYMDPICDLLYHIKYMFVG 1300
 
Name Accession Description Interval E-value
Med23 pfam11573
Mediator complex subunit 23; Med23 is one of the subunits of the Tail portion of the Mediator ...
1-1307 0e+00

Mediator complex subunit 23; Med23 is one of the subunits of the Tail portion of the Mediator complex that regulates RNA polymerase II activity. Med23 is required for heat-shock-specific gene expression, and has been shown to mediate transcriptional activation of E1A in mice.


Pssm-ID: 288430  Cd Length: 1300  Bit Score: 2196.76  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074      1 METQLQSIFEEVVKTEVIEEAFPGMFMDTPEDEKTKLISCLGAFRQFWGGLSQESHEQCIQWIVKFIHGQHSPKRISFLY 80
Cdd:pfam11573    1 EENQIKSIVNEILKVEAIEEAFSPFTSNLPDNEKEKTAILRKEFNNMMSKMSEEEKESAVRELLKLVHHVAEKNRLDFVF 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074     81 DCLAMAVETGLLPPRLVCESLINSDTLEWERTQLWALTFKLVRKIIGGVDYKGVRDLLKVILEKILTIPNTVSSAVVQQL 160
Cdd:pfam11573   81 QLLEYAVQKGVISARLVCEGLIMTEKLVYCNRLFWIECFKLIRKIIGGVDYKGVREILKYCLEKARRLPYRLSPEKVPQL 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    161 LAAREVIAYILERNACLLPAYFAVTEIRKLYPEGKLpHWLLGNLVSDFVDTFRPTARINSICGRCSLLPVVNNSG---AI 237
Cdd:pfam11573  161 RALENVIEYIFDRNACLLPAYFIVNEIMKGYPQNKM-HWRLAELLSNFVESFRPIAQMVSIIGRSFMLPVVEHSGyadHL 239
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    238 CNSWKLDPATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSRDMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSET 317
Cdd:pfam11573  240 TSPWKLDPNTLKFQLKGNLPYRPELLEPQTYLLRYVLEQPYSRDMVCSMLGLQKQQKQRCKALEEQLVELMICAMERSEN 319
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    318 EEKFDDGGTSQLLWQHLSSQLIFFVLFQFASFPHMVLSLHQKLAGRGLIKGRDHLMWVLLQFISGSIQKNALADFLPVMK 397
Cdd:pfam11573  320 ESLPEGEPIPHWQWLHLSSQLIYFVLFQFASFPHIVKALHEKLAGRDLRRGRDHLMWVLLQFISGSIQKNPLSDFLPILK 399
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    398 LFDLLYPEKEYIPVPDINKPQSTHAFAMTCIWIHLNRKAQNDNSKLQIPIPHSLRLHHEFLQQ-SLRNKSLQM---NDYK 473
Cdd:pfam11573  400 LYDLLYPEKEPLPVPDYNPALCTHQMAAACIWIHLLKKAQDENSNIQRPIPDALKSHHEFLQHlVLNNNSKNLamgSDYR 479
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    474 IALLCNAYSTNSECFTLPMGALVETIYGNGIMRIPLPgtncmASGSITPLPMNLLDSLTVHAKMSLIHSIATRVIKLAHA 553
Cdd:pfam11573  480 IALLCNAYSTNTEYFSRPMPALVETILGNSKSPSPGL-----APGPTVPLSMEFLDSLTVHSKMSLIHSIVTHVIKFAQT 554
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    554 KSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTLAAV 633
Cdd:pfam11573  555 KSPVPLAPALVETYSRLLVYTEIESLGIKGFISQLLPTVFKSHAWGILYTLLEMFSYRMHHIQPHYRVQLLSHLHSLANV 634
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    634 AQTNQNQLHLCVESTALRLITALGSSEVQPQFTRFLSDPKT--VLSAESEELNRALILTLARATHVTdfftGSDSIQGTW 711
Cdd:pfam11573  635 PQTNQTQLHLCVESTALRLITGLGSSEVQPQLSRFLSEPKTfvLVSAESEELNRALILTLARSMHIT----GTGSDSGSW 710
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    712 CKDILQTIMSFTPHNWASHTLSCFPGPLQAFFKQNNVPQESRFNLKKNVEEEYRKWKSMSNENDIITHFSMQGSPPLFLC 791
Cdd:pfam11573  711 CKDLLETIMQNTPHSWPEHTLQCFPPWLLEFFKQNDVPKENKQQLKKAVEEEYRKWASMTNENDIIAHFSVPGTPPLFLC 790
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    792 LLWKMLLETDHINQIGYRVLERIGARALVAHVRTFADFLVYEFSTSAGGQQLNKCIEILNDMVWKYNIVTLDRLILCLAM 871
Cdd:pfam11573  791 LLWKMILETDRISPIAYKILERIGARALSAHLRKFCDYLVFEVSNSCGGQHVNKCVDAINDMIWKYNIVTIDRLVLCLAL 870
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    872 RSHEGNEAQVCYFIIQLLLLKPNDFRNRVSDFVKENSPEHWLQNDWHTKHMNYHKKYPEKLYFEGLAEQVDPPvqiQSPY 951
Cdd:pfam11573  871 RTLEGNEAQVCFFIIQLLLLKTPEFRNRVQEFVKENSPEHWKQSNWHEKHLAFHRKFPEKFAPEGVLESGDSS---SYPS 947
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    952 LPIYFGNVCLRFLPVFDIVIHRFLELLPVSKSLETLLDHLGGLYKFHDRPVTYLYNTLHYYEMHLRDRAFLKRKLVHAII 1031
Cdd:pfam11573  948 LPTYFGNVCLRFLPVLDIVVHRYLELPQVSKSLETLLEHLGCLYKFHDRPVTYLYNTLHYYERKLRDRPDLKRKLVSAIL 1027
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074   1032 GSLKDNRPQGWCLSDTYLKCAMNAREENPWVPDDTYYCRLIGRLVDTMAGKSpgPFPNCDWRFNEFPNPAAHALHVTCVE 1111
Cdd:pfam11573 1028 GSLKECRPPGWALSEAYQKYHQKSSDEQLWQPELDYYMELIDRLVDTLDGKS--PFPATDWRFNEFPNPGAHALYVTCVE 1105
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074   1112 LMALAVSGKEVGNALLNVVLKSQPLVPRENITAWMNAIGLIITALPEPYWIVLHDRIVSVISSPSLTSETEWvGYPFRLF 1191
Cdd:pfam11573 1106 LMALPVSPETVANALIDVVQKGYHVIPSNEIHLWINAIGLILTALPEPYWSVLHDRLVEVLSSPELTNWTYR-NSPFELF 1184
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074   1192 DFTACHQSYSEMSCSYTLALAHAVWHHSSIGQLSLIPKFLTEVLLPIVKTEFQLLYVYHLVGPFLQRFQQERTRCMIEIG 1271
Cdd:pfam11573 1185 NFDNYHESLLENRYSYILALAHSVWHHAGIGQLNTFPQFVKEKLLPHVKTEEQLLYLCHLVGPFLRRFNSERPRCVLDIT 1264
                         1290      1300      1310
                   ....*....|....*....|....*....|....*.
gi 28558074   1272 VAFYDMLLNVDQCSTHLNYMDPICDFLYHMKYMFTG 1307
Cdd:pfam11573 1265 KLLYELLEQVDKHGVELVYMDPICDLLYHIKYMFVG 1300
 
Name Accession Description Interval E-value
Med23 pfam11573
Mediator complex subunit 23; Med23 is one of the subunits of the Tail portion of the Mediator ...
1-1307 0e+00

Mediator complex subunit 23; Med23 is one of the subunits of the Tail portion of the Mediator complex that regulates RNA polymerase II activity. Med23 is required for heat-shock-specific gene expression, and has been shown to mediate transcriptional activation of E1A in mice.


Pssm-ID: 288430  Cd Length: 1300  Bit Score: 2196.76  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074      1 METQLQSIFEEVVKTEVIEEAFPGMFMDTPEDEKTKLISCLGAFRQFWGGLSQESHEQCIQWIVKFIHGQHSPKRISFLY 80
Cdd:pfam11573    1 EENQIKSIVNEILKVEAIEEAFSPFTSNLPDNEKEKTAILRKEFNNMMSKMSEEEKESAVRELLKLVHHVAEKNRLDFVF 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074     81 DCLAMAVETGLLPPRLVCESLINSDTLEWERTQLWALTFKLVRKIIGGVDYKGVRDLLKVILEKILTIPNTVSSAVVQQL 160
Cdd:pfam11573   81 QLLEYAVQKGVISARLVCEGLIMTEKLVYCNRLFWIECFKLIRKIIGGVDYKGVREILKYCLEKARRLPYRLSPEKVPQL 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    161 LAAREVIAYILERNACLLPAYFAVTEIRKLYPEGKLpHWLLGNLVSDFVDTFRPTARINSICGRCSLLPVVNNSG---AI 237
Cdd:pfam11573  161 RALENVIEYIFDRNACLLPAYFIVNEIMKGYPQNKM-HWRLAELLSNFVESFRPIAQMVSIIGRSFMLPVVEHSGyadHL 239
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    238 CNSWKLDPATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSRDMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSET 317
Cdd:pfam11573  240 TSPWKLDPNTLKFQLKGNLPYRPELLEPQTYLLRYVLEQPYSRDMVCSMLGLQKQQKQRCKALEEQLVELMICAMERSEN 319
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    318 EEKFDDGGTSQLLWQHLSSQLIFFVLFQFASFPHMVLSLHQKLAGRGLIKGRDHLMWVLLQFISGSIQKNALADFLPVMK 397
Cdd:pfam11573  320 ESLPEGEPIPHWQWLHLSSQLIYFVLFQFASFPHIVKALHEKLAGRDLRRGRDHLMWVLLQFISGSIQKNPLSDFLPILK 399
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    398 LFDLLYPEKEYIPVPDINKPQSTHAFAMTCIWIHLNRKAQNDNSKLQIPIPHSLRLHHEFLQQ-SLRNKSLQM---NDYK 473
Cdd:pfam11573  400 LYDLLYPEKEPLPVPDYNPALCTHQMAAACIWIHLLKKAQDENSNIQRPIPDALKSHHEFLQHlVLNNNSKNLamgSDYR 479
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    474 IALLCNAYSTNSECFTLPMGALVETIYGNGIMRIPLPgtncmASGSITPLPMNLLDSLTVHAKMSLIHSIATRVIKLAHA 553
Cdd:pfam11573  480 IALLCNAYSTNTEYFSRPMPALVETILGNSKSPSPGL-----APGPTVPLSMEFLDSLTVHSKMSLIHSIVTHVIKFAQT 554
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    554 KSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTLAAV 633
Cdd:pfam11573  555 KSPVPLAPALVETYSRLLVYTEIESLGIKGFISQLLPTVFKSHAWGILYTLLEMFSYRMHHIQPHYRVQLLSHLHSLANV 634
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    634 AQTNQNQLHLCVESTALRLITALGSSEVQPQFTRFLSDPKT--VLSAESEELNRALILTLARATHVTdfftGSDSIQGTW 711
Cdd:pfam11573  635 PQTNQTQLHLCVESTALRLITGLGSSEVQPQLSRFLSEPKTfvLVSAESEELNRALILTLARSMHIT----GTGSDSGSW 710
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    712 CKDILQTIMSFTPHNWASHTLSCFPGPLQAFFKQNNVPQESRFNLKKNVEEEYRKWKSMSNENDIITHFSMQGSPPLFLC 791
Cdd:pfam11573  711 CKDLLETIMQNTPHSWPEHTLQCFPPWLLEFFKQNDVPKENKQQLKKAVEEEYRKWASMTNENDIIAHFSVPGTPPLFLC 790
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    792 LLWKMLLETDHINQIGYRVLERIGARALVAHVRTFADFLVYEFSTSAGGQQLNKCIEILNDMVWKYNIVTLDRLILCLAM 871
Cdd:pfam11573  791 LLWKMILETDRISPIAYKILERIGARALSAHLRKFCDYLVFEVSNSCGGQHVNKCVDAINDMIWKYNIVTIDRLVLCLAL 870
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    872 RSHEGNEAQVCYFIIQLLLLKPNDFRNRVSDFVKENSPEHWLQNDWHTKHMNYHKKYPEKLYFEGLAEQVDPPvqiQSPY 951
Cdd:pfam11573  871 RTLEGNEAQVCFFIIQLLLLKTPEFRNRVQEFVKENSPEHWKQSNWHEKHLAFHRKFPEKFAPEGVLESGDSS---SYPS 947
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074    952 LPIYFGNVCLRFLPVFDIVIHRFLELLPVSKSLETLLDHLGGLYKFHDRPVTYLYNTLHYYEMHLRDRAFLKRKLVHAII 1031
Cdd:pfam11573  948 LPTYFGNVCLRFLPVLDIVVHRYLELPQVSKSLETLLEHLGCLYKFHDRPVTYLYNTLHYYERKLRDRPDLKRKLVSAIL 1027
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074   1032 GSLKDNRPQGWCLSDTYLKCAMNAREENPWVPDDTYYCRLIGRLVDTMAGKSpgPFPNCDWRFNEFPNPAAHALHVTCVE 1111
Cdd:pfam11573 1028 GSLKECRPPGWALSEAYQKYHQKSSDEQLWQPELDYYMELIDRLVDTLDGKS--PFPATDWRFNEFPNPGAHALYVTCVE 1105
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074   1112 LMALAVSGKEVGNALLNVVLKSQPLVPRENITAWMNAIGLIITALPEPYWIVLHDRIVSVISSPSLTSETEWvGYPFRLF 1191
Cdd:pfam11573 1106 LMALPVSPETVANALIDVVQKGYHVIPSNEIHLWINAIGLILTALPEPYWSVLHDRLVEVLSSPELTNWTYR-NSPFELF 1184
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28558074   1192 DFTACHQSYSEMSCSYTLALAHAVWHHSSIGQLSLIPKFLTEVLLPIVKTEFQLLYVYHLVGPFLQRFQQERTRCMIEIG 1271
Cdd:pfam11573 1185 NFDNYHESLLENRYSYILALAHSVWHHAGIGQLNTFPQFVKEKLLPHVKTEEQLLYLCHLVGPFLRRFNSERPRCVLDIT 1264
                         1290      1300      1310
                   ....*....|....*....|....*....|....*.
gi 28558074   1272 VAFYDMLLNVDQCSTHLNYMDPICDFLYHMKYMFTG 1307
Cdd:pfam11573 1265 KLLYELLEQVDKHGVELVYMDPICDLLYHIKYMFVG 1300
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH