NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|135934|sp|P01375|]
View 

RecName: Full=Tumor necrosis factor; AltName: Full=Cachectin; AltName: Full=TNF-alpha; AltName: Full=Tumor necrosis factor ligand superfamily member 2; Short=TNF-a; Contains: RecName: Full=Tumor necrosis factor, membrane form; AltName: Full=N-terminal fragment; Short=NTF; Contains: RecName: Full=Intracellular domain 1; Short=ICD1; Contains: RecName: Full=Intracellular domain 2; Short=ICD2; Contains: RecName: Full=C-domain 1; Contains: RecName: Full=C-domain 2; Contains: RecName: Full=Tumor necrosis factor, soluble form; Flags: Precursor [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TNF cd00184
Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT ...
88-231 1.55e-42

Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT (lymphotoxin-alpha, TNF-beta), CD40 ligand, Apo2L (TRAIL), Fas ligand, and osteoprotegerin (OPG) ligand. These proteins generally have an intracellular N-terminal domain, a short transmembrane segment, an extracellular stalk, and a globular TNF-like extracellular domain of about 150 residues. They initiate apoptosis by binding to related receptors, some of which have intracellular death domains. They generally form homo- or hetero- trimeric complexes.TNF cytokines bind one elongated receptor molecule along each of three clefts formed by neighboring monomers of the trimer with ligand trimerization a requiste for receptor binding.


:

Pssm-ID: 238108  Cd Length: 137  Bit Score: 142.48  E-value: 1.55e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 135934    88 PVAHVVANPQA--EGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSthVLLTHTISRIAVSYQT 165
Cdd:cd00184   1 PAAHLIGTNSSsgGTGLSWESDDGRAFLSGGLELQNGELVVPQDGLYYIYSQVYFRGQCCST--LSVSHVLQLRTDSYPE 78
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 135934   166 KVNLLSAIKSPCQretpegAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAEsGQVYFGII 231
Cdd:cd00184  79 PILLLKGIRSVCS------SVSEGWYNSVYLGGLFQLRAGDRLSVNVSAPALLDLSQ-GTTFFGAF 137
 
Name Accession Description Interval E-value
TNF cd00184
Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT ...
88-231 1.55e-42

Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT (lymphotoxin-alpha, TNF-beta), CD40 ligand, Apo2L (TRAIL), Fas ligand, and osteoprotegerin (OPG) ligand. These proteins generally have an intracellular N-terminal domain, a short transmembrane segment, an extracellular stalk, and a globular TNF-like extracellular domain of about 150 residues. They initiate apoptosis by binding to related receptors, some of which have intracellular death domains. They generally form homo- or hetero- trimeric complexes.TNF cytokines bind one elongated receptor molecule along each of three clefts formed by neighboring monomers of the trimer with ligand trimerization a requiste for receptor binding.


Pssm-ID: 238108  Cd Length: 137  Bit Score: 142.48  E-value: 1.55e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 135934    88 PVAHVVANPQA--EGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSthVLLTHTISRIAVSYQT 165
Cdd:cd00184   1 PAAHLIGTNSSsgGTGLSWESDDGRAFLSGGLELQNGELVVPQDGLYYIYSQVYFRGQCCST--LSVSHVLQLRTDSYPE 78
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 135934   166 KVNLLSAIKSPCQretpegAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAEsGQVYFGII 231
Cdd:cd00184  79 PILLLKGIRSVCS------SVSEGWYNSVYLGGLFQLRAGDRLSVNVSAPALLDLSQ-GTTFFGAF 137
TNF pfam00229
TNF(tumor Necrosis Factor) family;
102-233 3.11e-53

TNF(tumor Necrosis Factor) family;


Pssm-ID: 249699  Cd Length: 127  Bit Score: 169.86  E-value: 3.11e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 135934     102 LQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRET 181
Cdd:pfam00229   1 LSWEKNDGGASLSGGMELQDGELVIPQDGLYYIYSQVSFRGVSCSSRSVPLTHSLYRKSDSYPDPVPLLKGVRSPCTSKT 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 135934     182 PEgaeakPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL 233
Cdd:pfam00229  81 SE-----YWYQSVYLGGLFQLRAGDRLSVNVSNLSLVDLSEPGKTFFGAFLL 127
TNF smart00207
Tumour necrosis factor family; Family of cytokines that form homotrimeric or heterotrimeric ...
102-233 3.06e-41

Tumour necrosis factor family; Family of cytokines that form homotrimeric or heterotrimeric complexes. TNF mediates mature T-cell receptor-induced apoptosis through the p75 TNF receptor.


Pssm-ID: 214557  Cd Length: 125  Bit Score: 139.02  E-value: 3.06e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 135934      102 LQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQret 181
Cdd:smart00207   1 LSWESDRGLASLLSGMELQNGELVVPRDGLYYIYSQVYFRGQGCNGKSVELSLSLHLRKPSYPLPLLLLEAARSSCW--- 77
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|..
gi 135934      182 pegAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAEsGQVYFGIIAL 233
Cdd:smart00207  78 ---SASSAWKDSVYLGGLFPLTAGDRLSVNVTEPSLVDLAP-GATFFGAFLV 125
 
Name Accession Description Interval E-value
TNF cd00184
Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT ...
88-231 1.55e-42

Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT (lymphotoxin-alpha, TNF-beta), CD40 ligand, Apo2L (TRAIL), Fas ligand, and osteoprotegerin (OPG) ligand. These proteins generally have an intracellular N-terminal domain, a short transmembrane segment, an extracellular stalk, and a globular TNF-like extracellular domain of about 150 residues. They initiate apoptosis by binding to related receptors, some of which have intracellular death domains. They generally form homo- or hetero- trimeric complexes.TNF cytokines bind one elongated receptor molecule along each of three clefts formed by neighboring monomers of the trimer with ligand trimerization a requiste for receptor binding.


Pssm-ID: 238108  Cd Length: 137  Bit Score: 142.48  E-value: 1.55e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 135934    88 PVAHVVANPQA--EGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSthVLLTHTISRIAVSYQT 165
Cdd:cd00184   1 PAAHLIGTNSSsgGTGLSWESDDGRAFLSGGLELQNGELVVPQDGLYYIYSQVYFRGQCCST--LSVSHVLQLRTDSYPE 78
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 135934   166 KVNLLSAIKSPCQretpegAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAEsGQVYFGII 231
Cdd:cd00184  79 PILLLKGIRSVCS------SVSEGWYNSVYLGGLFQLRAGDRLSVNVSAPALLDLSQ-GTTFFGAF 137
TNF pfam00229
TNF(tumor Necrosis Factor) family;
102-233 3.11e-53

TNF(tumor Necrosis Factor) family;


Pssm-ID: 249699  Cd Length: 127  Bit Score: 169.86  E-value: 3.11e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 135934     102 LQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRET 181
Cdd:pfam00229   1 LSWEKNDGGASLSGGMELQDGELVIPQDGLYYIYSQVSFRGVSCSSRSVPLTHSLYRKSDSYPDPVPLLKGVRSPCTSKT 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 135934     182 PEgaeakPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL 233
Cdd:pfam00229  81 SE-----YWYQSVYLGGLFQLRAGDRLSVNVSNLSLVDLSEPGKTFFGAFLL 127
TNF smart00207
Tumour necrosis factor family; Family of cytokines that form homotrimeric or heterotrimeric ...
102-233 3.06e-41

Tumour necrosis factor family; Family of cytokines that form homotrimeric or heterotrimeric complexes. TNF mediates mature T-cell receptor-induced apoptosis through the p75 TNF receptor.


Pssm-ID: 214557  Cd Length: 125  Bit Score: 139.02  E-value: 3.06e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 135934      102 LQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQret 181
Cdd:smart00207   1 LSWESDRGLASLLSGMELQNGELVVPRDGLYYIYSQVYFRGQGCNGKSVELSLSLHLRKPSYPLPLLLLEAARSSCW--- 77
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|..
gi 135934      182 pegAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAEsGQVYFGIIAL 233
Cdd:smart00207  78 ---SASSAWKDSVYLGGLFPLTAGDRLSVNVTEPSLVDLAP-GATFFGAFLV 125
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH