NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|29836496|ref|NP_828851.1|]
View 

E2 glycoprotein precursor [SARS coronavirus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Corona_S2 pfam01601
Coronavirus S2 glycoprotein; The coronavirus spike glycoprotein forms the characteristic ...
647-1255 0e+00

Coronavirus S2 glycoprotein; The coronavirus spike glycoprotein forms the characteristic 'corona' after which the group is named. The Spike glycoprotein is translated as a large polypeptide that is subsequently cleaved to S1 pfam01600 and S2.


:

Pssm-ID: 250736  Cd Length: 609  Bit Score: 867.77  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    647 ECDIPIgagicASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICG 726
Cdd:pfam01601    1 NCTLPV-----LTYSTISVCRDGSIISVGPRNTSQNSVSPILTSVGNVSIPTNFTLSVTTEYIQTTSPKVTIDCAQYVCN 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    727 DSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFGG-FNFSQILPDP-LKPTKRSFIEDLL 804
Cdd:pfam01601   76 GNTRCLKLLQQYGSFCDNINSALNGVARLEDMEVLSMLSASKQGLTLATVSNFGGdYNFSLLLPSNgSKPSGRSAIEDLL 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    805 FNKVTLADAGFMKQ-YGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTfgagAALQIPFAMQ 883
Cdd:pfam01601  156 FNKVVTSGLGTVDEdYKKCTGGGSIADLICAQYYNGIMVLPPVVDAEMMAMYTASLVGAMALGGIT----AAAAIPFATQ 231
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    884 MAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDIL 963
Cdd:pfam01601  232 VQARLNYVGLTTDVLQENQKLIANSFNKALGNIQDGFTTTASALSKIQDVVNQQGQALSQLTNQLSNNFGAISSSIQDIY 311
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    964 SRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVV 1043
Cdd:pfam01601  312 SRLDALEADAQVDRLITGRLTALNAYVSQQLTRYTEVRASRQLAQQKVNECVKSQSKRYGFCGNGTHIFSLVQNAPNGLL 391
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496   1044 FLHVTYVPSQERNFTTAPAICHEG----KAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTV 1119
Cdd:pfam01601  392 FLHTVYVPTQYVNVTASPGLCVNGtngyVLRAPGLGLFVQNNGSWYITGRSMYEPRPITASDFVQLTSCDVNYVNITNTV 471
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496   1120 YDPLQPELDSFKEELDKYFKNHTSPDVDLgDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVW 1199
Cdd:pfam01601  472 LPPIIPDYIDFNKELDKWFKNLNSTVPDL-DLDKFNATILNLTGEIDRLQEVIKNLNDSLIDLEWLNRYETYIKWPWYVW 550
                          570       580       590       600       610       620
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 29836496   1200 LGFIAGLIAIVMVTILLCCMTSCC---SCLKgaCSCGSCCK--FDEDDSEPVLKGVKLHYT 1255
Cdd:pfam01601  551 LAIGAALIAFVLLLLFCCCMTGCCgccGCFG--SKCGGCCSyyTTFDDLVPYEPVEKKHVV 609
Spike_rec_bind pfam09408
Spike receptor binding domain; Spike is an envelope glycoprotein which aids viral entry into ...
317-569 1.62e-96

Spike receptor binding domain; Spike is an envelope glycoprotein which aids viral entry into the host cell. This domain corresponds is the immunogenic receptor binding domain of the protein which binds to angiotensin-converting enzyme 2 (ACE2).


:

Pssm-ID: 255344  Cd Length: 212  Bit Score: 308.24  E-value: 1.62e-96
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    317 PNITNlCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQ 396
Cdd:pfam09408    1 PNLPD-CPIEEWLNAKSVPSPLNWERKTFSNCNFNLSSLLRSVQADSFSCNNIDASKLYGMCFGSVTVDKFAIPNSRVVD 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    397 IAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTgNYNYKYrylrhgklrpferdisnvpfspdgkpctppaLNCYW 476
Cdd:pfam09408   80 LQLGNSGFLQSYNYKIDTAATSCQLYYSLPKNNVTIN-NYNPSS-------------------------------WNRRY 127
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    477 PLNDYGFYTttgigyQPYRVVVLSFELLNAPATVCGPKLSTdlIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVS 556
Cdd:pfam09408  128 GFNDYGFFG------QSDHDVVYSFECFNVPNTYCPCKLPT--IKSQCVNFNFNGKTGTGVCPVGTKYRQCFQQFGRDVS 199
                          250
                   ....*....|...
gi 29836496    557 DFTDSVRDPKTSE 569
Cdd:pfam09408  200 DFCDCVCDPDPIT 212
 
Name Accession Description Interval E-value
Corona_S2 pfam01601
Coronavirus S2 glycoprotein; The coronavirus spike glycoprotein forms the characteristic ...
647-1255 0e+00

Coronavirus S2 glycoprotein; The coronavirus spike glycoprotein forms the characteristic 'corona' after which the group is named. The Spike glycoprotein is translated as a large polypeptide that is subsequently cleaved to S1 pfam01600 and S2.


Pssm-ID: 250736  Cd Length: 609  Bit Score: 867.77  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    647 ECDIPIgagicASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICG 726
Cdd:pfam01601    1 NCTLPV-----LTYSTISVCRDGSIISVGPRNTSQNSVSPILTSVGNVSIPTNFTLSVTTEYIQTTSPKVTIDCAQYVCN 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    727 DSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFGG-FNFSQILPDP-LKPTKRSFIEDLL 804
Cdd:pfam01601   76 GNTRCLKLLQQYGSFCDNINSALNGVARLEDMEVLSMLSASKQGLTLATVSNFGGdYNFSLLLPSNgSKPSGRSAIEDLL 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    805 FNKVTLADAGFMKQ-YGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTfgagAALQIPFAMQ 883
Cdd:pfam01601  156 FNKVVTSGLGTVDEdYKKCTGGGSIADLICAQYYNGIMVLPPVVDAEMMAMYTASLVGAMALGGIT----AAAAIPFATQ 231
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    884 MAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDIL 963
Cdd:pfam01601  232 VQARLNYVGLTTDVLQENQKLIANSFNKALGNIQDGFTTTASALSKIQDVVNQQGQALSQLTNQLSNNFGAISSSIQDIY 311
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    964 SRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVV 1043
Cdd:pfam01601  312 SRLDALEADAQVDRLITGRLTALNAYVSQQLTRYTEVRASRQLAQQKVNECVKSQSKRYGFCGNGTHIFSLVQNAPNGLL 391
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496   1044 FLHVTYVPSQERNFTTAPAICHEG----KAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTV 1119
Cdd:pfam01601  392 FLHTVYVPTQYVNVTASPGLCVNGtngyVLRAPGLGLFVQNNGSWYITGRSMYEPRPITASDFVQLTSCDVNYVNITNTV 471
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496   1120 YDPLQPELDSFKEELDKYFKNHTSPDVDLgDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVW 1199
Cdd:pfam01601  472 LPPIIPDYIDFNKELDKWFKNLNSTVPDL-DLDKFNATILNLTGEIDRLQEVIKNLNDSLIDLEWLNRYETYIKWPWYVW 550
                          570       580       590       600       610       620
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 29836496   1200 LGFIAGLIAIVMVTILLCCMTSCC---SCLKgaCSCGSCCK--FDEDDSEPVLKGVKLHYT 1255
Cdd:pfam01601  551 LAIGAALIAFVLLLLFCCCMTGCCgccGCFG--SKCGGCCSyyTTFDDLVPYEPVEKKHVV 609
Spike_rec_bind pfam09408
Spike receptor binding domain; Spike is an envelope glycoprotein which aids viral entry into ...
317-569 1.62e-96

Spike receptor binding domain; Spike is an envelope glycoprotein which aids viral entry into the host cell. This domain corresponds is the immunogenic receptor binding domain of the protein which binds to angiotensin-converting enzyme 2 (ACE2).


Pssm-ID: 255344  Cd Length: 212  Bit Score: 308.24  E-value: 1.62e-96
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    317 PNITNlCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQ 396
Cdd:pfam09408    1 PNLPD-CPIEEWLNAKSVPSPLNWERKTFSNCNFNLSSLLRSVQADSFSCNNIDASKLYGMCFGSVTVDKFAIPNSRVVD 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    397 IAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTgNYNYKYrylrhgklrpferdisnvpfspdgkpctppaLNCYW 476
Cdd:pfam09408   80 LQLGNSGFLQSYNYKIDTAATSCQLYYSLPKNNVTIN-NYNPSS-------------------------------WNRRY 127
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    477 PLNDYGFYTttgigyQPYRVVVLSFELLNAPATVCGPKLSTdlIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVS 556
Cdd:pfam09408  128 GFNDYGFFG------QSDHDVVYSFECFNVPNTYCPCKLPT--IKSQCVNFNFNGKTGTGVCPVGTKYRQCFQQFGRDVS 199
                          250
                   ....*....|...
gi 29836496    557 DFTDSVRDPKTSE 569
Cdd:pfam09408  200 DFCDCVCDPDPIT 212
 
Name Accession Description Interval E-value
Corona_S2 pfam01601
Coronavirus S2 glycoprotein; The coronavirus spike glycoprotein forms the characteristic ...
647-1255 0e+00

Coronavirus S2 glycoprotein; The coronavirus spike glycoprotein forms the characteristic 'corona' after which the group is named. The Spike glycoprotein is translated as a large polypeptide that is subsequently cleaved to S1 pfam01600 and S2.


Pssm-ID: 250736  Cd Length: 609  Bit Score: 867.77  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    647 ECDIPIgagicASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICG 726
Cdd:pfam01601    1 NCTLPV-----LTYSTISVCRDGSIISVGPRNTSQNSVSPILTSVGNVSIPTNFTLSVTTEYIQTTSPKVTIDCAQYVCN 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    727 DSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFGG-FNFSQILPDP-LKPTKRSFIEDLL 804
Cdd:pfam01601   76 GNTRCLKLLQQYGSFCDNINSALNGVARLEDMEVLSMLSASKQGLTLATVSNFGGdYNFSLLLPSNgSKPSGRSAIEDLL 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    805 FNKVTLADAGFMKQ-YGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTfgagAALQIPFAMQ 883
Cdd:pfam01601  156 FNKVVTSGLGTVDEdYKKCTGGGSIADLICAQYYNGIMVLPPVVDAEMMAMYTASLVGAMALGGIT----AAAAIPFATQ 231
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    884 MAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDIL 963
Cdd:pfam01601  232 VQARLNYVGLTTDVLQENQKLIANSFNKALGNIQDGFTTTASALSKIQDVVNQQGQALSQLTNQLSNNFGAISSSIQDIY 311
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    964 SRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVV 1043
Cdd:pfam01601  312 SRLDALEADAQVDRLITGRLTALNAYVSQQLTRYTEVRASRQLAQQKVNECVKSQSKRYGFCGNGTHIFSLVQNAPNGLL 391
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496   1044 FLHVTYVPSQERNFTTAPAICHEG----KAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTV 1119
Cdd:pfam01601  392 FLHTVYVPTQYVNVTASPGLCVNGtngyVLRAPGLGLFVQNNGSWYITGRSMYEPRPITASDFVQLTSCDVNYVNITNTV 471
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496   1120 YDPLQPELDSFKEELDKYFKNHTSPDVDLgDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVW 1199
Cdd:pfam01601  472 LPPIIPDYIDFNKELDKWFKNLNSTVPDL-DLDKFNATILNLTGEIDRLQEVIKNLNDSLIDLEWLNRYETYIKWPWYVW 550
                          570       580       590       600       610       620
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 29836496   1200 LGFIAGLIAIVMVTILLCCMTSCC---SCLKgaCSCGSCCK--FDEDDSEPVLKGVKLHYT 1255
Cdd:pfam01601  551 LAIGAALIAFVLLLLFCCCMTGCCgccGCFG--SKCGGCCSyyTTFDDLVPYEPVEKKHVV 609
Spike_rec_bind pfam09408
Spike receptor binding domain; Spike is an envelope glycoprotein which aids viral entry into ...
317-569 1.62e-96

Spike receptor binding domain; Spike is an envelope glycoprotein which aids viral entry into the host cell. This domain corresponds is the immunogenic receptor binding domain of the protein which binds to angiotensin-converting enzyme 2 (ACE2).


Pssm-ID: 255344  Cd Length: 212  Bit Score: 308.24  E-value: 1.62e-96
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    317 PNITNlCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQ 396
Cdd:pfam09408    1 PNLPD-CPIEEWLNAKSVPSPLNWERKTFSNCNFNLSSLLRSVQADSFSCNNIDASKLYGMCFGSVTVDKFAIPNSRVVD 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    397 IAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTgNYNYKYrylrhgklrpferdisnvpfspdgkpctppaLNCYW 476
Cdd:pfam09408   80 LQLGNSGFLQSYNYKIDTAATSCQLYYSLPKNNVTIN-NYNPSS-------------------------------WNRRY 127
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29836496    477 PLNDYGFYTttgigyQPYRVVVLSFELLNAPATVCGPKLSTdlIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVS 556
Cdd:pfam09408  128 GFNDYGFFG------QSDHDVVYSFECFNVPNTYCPCKLPT--IKSQCVNFNFNGKTGTGVCPVGTKYRQCFQQFGRDVS 199
                          250
                   ....*....|...
gi 29836496    557 DFTDSVRDPKTSE 569
Cdd:pfam09408  200 DFCDCVCDPDPIT 212
DUF148 pfam02520
Domain of unknown function DUF148; This domain has no known function nor do any of the ...
889-963 7.20e-03

Domain of unknown function DUF148; This domain has no known function nor do any of the proteins that possess it. In one member of this family the aligned region is repeated twice.


Pssm-ID: 251349  Cd Length: 115  Bit Score: 36.46  E-value: 7.20e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 29836496    889 NGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQN----AQALNTLVKQLSSNFGAISSVLNDIL 963
Cdd:pfam02520   33 YGVADQYEEFKKNVKALKAEAEKNVTAVISNLSSVDAKLSAILDNKDLTrrqkKEAIDALKKQLPQEVSTLFFIRKEIL 111
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH