NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|121674801|ref|NP_689935|]
View 

hepatocyte cell adhesion molecule precursor [Homo sapiens]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ig cd00096
Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
165-222 1.04e-08

Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


:

Pssm-ID: 143165 [Multi-domain]  Cd Length: 74  Bit Score: 51.72  E-value: 1.04e-08
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 121674801 165 TLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQK------VLTITRVLMEDDDLYSCMVENP 222
Cdd:cd00096    2 TLTCLASGPPPPTITWLKNGKPLPSSVLTRVRSSRGtssgssTLTISNVTLEDSGTYTCVASNS 65
Ig_CEACAM_D1_like cd05741
First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion ...
48-141 1.18e-07

First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins; Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D1 Ig-like domain. Also belonging to this group is the N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84-like family. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. SLAM family proteins are organized as an extracellular domain with having two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region having tyr-based motifs. The extracellular domain is organized as a membrane-distal Ig variable (IgV) domain that is responsible for ligand recognition and a membrane-proximal truncated Ig constant-2 (IgC2) domain.


:

Pssm-ID: 143218 [Multi-domain]  Cd Length: 92  Bit Score: 49.23  E-value: 1.18e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801  48 GKSALLSVQYSSTSSDRpvVKWqlKRDKPVTVVQSIGTEV---IGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEI 124
Cdd:cd05741    1 GESVTLPVSNLPENLQE--ITW--YKGKDKSVEAEIASYIatnSTVFGPAYSGRETIYPNGSLLIQNLTKEDSGTYTLQI 76
                         90
                 ....*....|....*..
gi 121674801 125 sITDDTFTGEKTINLTV 141
Cdd:cd05741   77 -ISTNGVTENAKFFLRV 92
IGc2 smart00408
Immunoglobulin C-2 Type;
162-224 1.87e-10

Immunoglobulin C-2 Type;


:

Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 56.65  E-value: 1.87e-10
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 121674801   162 EAFTLNCSHENGTKPSYTWLKDGKPLlnDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPIS 224
Cdd:smart00408   3 QSVTLTCPAEGNPVPNITWLKDGKPL--PESNRFVASGSTLTIKSVSLEDSGLYTCVAENSAG 63
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
43-141 3.25e-05

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


:

Pssm-ID: 214653 [Multi-domain]  Cd Length: 85  Bit Score: 41.72  E-value: 3.25e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801    43 IHGTVGKSALLSVQYSSTSSdrPVVKWQLKRDKPVTvvqsigtevigtlrpdYRDRIRLFENG---SLLLSDLQLADEGT 119
Cdd:smart00410   4 VTVKEGESVTLSCEASGSPP--PEVTWYKQGGKLLA----------------ESGRFSVSRSGstsTLTISNVTPEDSGT 65
                           90       100
                   ....*....|....*....|..
gi 121674801   120 YevEISITDDTFTGEKTINLTV 141
Cdd:smart00410  66 Y--TCAATNSSGSASSGTTLTV 85
 
Name Accession Description Interval E-value
Ig cd00096
Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
165-222 1.04e-08

Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 143165 [Multi-domain]  Cd Length: 74  Bit Score: 51.72  E-value: 1.04e-08
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 121674801 165 TLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQK------VLTITRVLMEDDDLYSCMVENP 222
Cdd:cd00096    2 TLTCLASGPPPPTITWLKNGKPLPSSVLTRVRSSRGtssgssTLTISNVTLEDSGTYTCVASNS 65
Ig_2 pfam13895
Immunoglobulin domain; This domain contains immunoglobulin-like domains.
150-235 1.28e-12

Immunoglobulin domain; This domain contains immunoglobulin-like domains.


Pssm-ID: 258162  Cd Length: 80  Bit Score: 63.20  E-value: 1.28e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801  150 VLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPllndsrmlLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSL 229
Cdd:pfam13895   3 VLTASPTVVFEGEDVTLTCSAPGNPPPNYTWYKDGTA--------LSSSQNGSFTPNVSESDSGTYTCTARNGGGSKTSN 74

                  ....*.
gi 121674801  230 PVKITV 235
Cdd:pfam13895  75 PVELTV 80
Ig_CEACAM_D1_like cd05741
First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion ...
48-141 1.18e-07

First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins; Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D1 Ig-like domain. Also belonging to this group is the N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84-like family. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. SLAM family proteins are organized as an extracellular domain with having two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region having tyr-based motifs. The extracellular domain is organized as a membrane-distal Ig variable (IgV) domain that is responsible for ligand recognition and a membrane-proximal truncated Ig constant-2 (IgC2) domain.


Pssm-ID: 143218 [Multi-domain]  Cd Length: 92  Bit Score: 49.23  E-value: 1.18e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801  48 GKSALLSVQYSSTSSDRpvVKWqlKRDKPVTVVQSIGTEV---IGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEI 124
Cdd:cd05741    1 GESVTLPVSNLPENLQE--ITW--YKGKDKSVEAEIASYIatnSTVFGPAYSGRETIYPNGSLLIQNLTKEDSGTYTLQI 76
                         90
                 ....*....|....*..
gi 121674801 125 sITDDTFTGEKTINLTV 141
Cdd:cd05741   77 -ISTNGVTENAKFFLRV 92
IGv smart00406
Immunoglobulin V-Type;
50-120 1.85e-03

Immunoglobulin V-Type;


Pssm-ID: 214650  Cd Length: 81  Bit Score: 36.21  E-value: 1.85e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 121674801    50 SALLSVQYSSTSSDRPVVKWQLKR-DKPVTVVQSIGTEVIGTLRPDYRDRIRL-----FENGSLLLSDLQLADEGTY 120
Cdd:smart00406   1 SVTLSCKFSGSTFSSYYVSWVRQPpGKGLEWLGYIGSNGSSYYQESYKGRFTIskdtsKNDVSLTISNLRVEDTGTY 77
IGc2 smart00408
Immunoglobulin C-2 Type;
162-224 1.87e-10

Immunoglobulin C-2 Type;


Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 56.65  E-value: 1.87e-10
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 121674801   162 EAFTLNCSHENGTKPSYTWLKDGKPLlnDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPIS 224
Cdd:smart00408   3 QSVTLTCPAEGNPVPNITWLKDGKPL--PESNRFVASGSTLTIKSVSLEDSGLYTCVAENSAG 63
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
43-141 3.25e-05

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653 [Multi-domain]  Cd Length: 85  Bit Score: 41.72  E-value: 3.25e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801    43 IHGTVGKSALLSVQYSSTSSdrPVVKWQLKRDKPVTvvqsigtevigtlrpdYRDRIRLFENG---SLLLSDLQLADEGT 119
Cdd:smart00410   4 VTVKEGESVTLSCEASGSPP--PEVTWYKQGGKLLA----------------ESGRFSVSRSGstsTLTISNVTPEDSGT 65
                           90       100
                   ....*....|....*....|..
gi 121674801   120 YevEISITDDTFTGEKTINLTV 141
Cdd:smart00410  66 Y--TCAATNSSGSASSGTTLTV 85
I-set pfam07679
Immunoglobulin I-set domain;
175-225 2.77e-06

Immunoglobulin I-set domain;


Pssm-ID: 254352 [Multi-domain]  Cd Length: 90  Bit Score: 44.94  E-value: 2.77e-06
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 121674801  175 KPSYTWLKDGKPLLNDSRMLLSPDQKV--LTITRVLMEDDDLYSCMVENPISQ 225
Cdd:pfam07679  29 DPEVSWFKDGQPLRSSDRFKVTYEGGTytLTISNVQPDDSGKYTCVATNSAGE 81
PHA03247 PHA03247
large tegument protein UL36; Provisional
315-399 6.58e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 40.69  E-value: 6.58e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801  315 DKDSPETEENPAPEPRSATEPGPPGYSVSPAvpGRSPGLPIRSARRYPRSPARSPATGRTHsspprapsspgRSRSASRT 394
Cdd:PHA03247 2604 DRGDPRGPAPPSPLPPDTHAPDPPPPSPSPA--ANEPDPHPPPTVPPPERPRDDPAPGRVS-----------RPRRARRL 2670

                  ....*
gi 121674801  395 LRTAG 399
Cdd:PHA03247 2671 GRAAQ 2675
PHA02826 PHA02826
IL-1 receptor-like protein; Provisional
103-217 1.66e-03

IL-1 receptor-like protein; Provisional


Pssm-ID: 165173 [Multi-domain]  Cd Length: 227  Bit Score: 38.36  E-value: 1.66e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801 103 ENGS----LLLSDLQLADEGTYEVEISitDDTFTGEKTINLTVDvpisrpqvlvASTTVLELSEAF--TLNCSHENGTKP 176
Cdd:PHA02826  92 EIGDrsenLWIGNVINIDEGIYICTIS--SGNICEESTIRLTFD----------SGTINYQFNSGKdsKLHCYGTDGISS 159
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 121674801 177 SY-----TWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSC 217
Cdd:PHA02826 160 TFkdytlTWYKNGNIVLYTDRIQLRNNNSTLVIKSATHDDSGIYTC 205
 
Name Accession Description Interval E-value
Ig cd00096
Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
165-222 1.04e-08

Immunoglobulin domain; Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 143165 [Multi-domain]  Cd Length: 74  Bit Score: 51.72  E-value: 1.04e-08
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 121674801 165 TLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQK------VLTITRVLMEDDDLYSCMVENP 222
Cdd:cd00096    2 TLTCLASGPPPPTITWLKNGKPLPSSVLTRVRSSRGtssgssTLTISNVTLEDSGTYTCVASNS 65
Ig_2 pfam13895
Immunoglobulin domain; This domain contains immunoglobulin-like domains.
150-235 1.28e-12

Immunoglobulin domain; This domain contains immunoglobulin-like domains.


Pssm-ID: 258162  Cd Length: 80  Bit Score: 63.20  E-value: 1.28e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801  150 VLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPllndsrmlLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSL 229
Cdd:pfam13895   3 VLTASPTVVFEGEDVTLTCSAPGNPPPNYTWYKDGTA--------LSSSQNGSFTPNVSESDSGTYTCTARNGGGSKTSN 74

                  ....*.
gi 121674801  230 PVKITV 235
Cdd:pfam13895  75 PVELTV 80
Ig_3 pfam13927
Immunoglobulin domain; This family contains immunoglobulin-like domains.
147-221 1.62e-08

Immunoglobulin domain; This family contains immunoglobulin-like domains.


Pssm-ID: 258189  Cd Length: 75  Bit Score: 51.21  E-value: 1.62e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 121674801  147 RPQVLV-ASTTVLELSEAFTLNCSHENGTKP-SYTWLKDGKplLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVEN 221
Cdd:pfam13927   1 KPVITVsPSPSVTSGGGGVTLTCSAEGGPPPpTISWYRNGS--ISNGSGGLGSSGSTLTISSVTPEDSGTYTCVASN 75
Ig_CEACAM_D1_like cd05741
First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion ...
48-141 1.18e-07

First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins; Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D1 Ig-like domain. Also belonging to this group is the N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84-like family. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. SLAM family proteins are organized as an extracellular domain with having two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region having tyr-based motifs. The extracellular domain is organized as a membrane-distal Ig variable (IgV) domain that is responsible for ligand recognition and a membrane-proximal truncated Ig constant-2 (IgC2) domain.


Pssm-ID: 143218 [Multi-domain]  Cd Length: 92  Bit Score: 49.23  E-value: 1.18e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801  48 GKSALLSVQYSSTSSDRpvVKWqlKRDKPVTVVQSIGTEV---IGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEI 124
Cdd:cd05741    1 GESVTLPVSNLPENLQE--ITW--YKGKDKSVEAEIASYIatnSTVFGPAYSGRETIYPNGSLLIQNLTKEDSGTYTLQI 76
                         90
                 ....*....|....*..
gi 121674801 125 sITDDTFTGEKTINLTV 141
Cdd:cd05741   77 -ISTNGVTENAKFFLRV 92
Ig4_Contactin-2-like cd05728
Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins; ...
152-221 4.44e-07

Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins; Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.


Pssm-ID: 143205  Cd Length: 85  Bit Score: 47.21  E-value: 4.44e-07
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801 152 VASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQkvLTITRVLMEDDDLYSCMVEN 221
Cdd:cd05728    5 VISDTEADIGSSLRWECKASGNPRPAYRWLKNGQPLASENRIEVEAGD--LRITKLSLSDSGMYQCVAEN 72
Ig_CEACAM_D4 cd05740
Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion ...
159-235 4.57e-07

Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM); Ig_CEACAM_D4: immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D4 Ig-like domain.


Pssm-ID: 143217  Cd Length: 91  Bit Score: 47.27  E-value: 4.57e-07
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 121674801 159 ELSEAFTLNCSHENGTKpSYTWLKDGKPLLNdSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKITV 235
Cdd:cd05740   16 EDNQPVTLTCEAEGQAT-YIWWVNNGSLLVP-PRLQLSNDNRTLTFNNVTRSDTGHYQCEASNEVSNMTSDPYILNV 90
Ig_SLAM-CD84_like_N cd05775
N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule ...
45-141 5.09e-07

N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like; Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region having Tyr-based motifs. The extracellular domain is organized as a membrane-distal Ig variable (IgV) domain that is responsible for ligand recognition and a membrane-proximal truncated Ig constant-2 (IgC2) domain.


Pssm-ID: 143252  Cd Length: 97  Bit Score: 47.32  E-value: 5.09e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801  45 GTVGKSALLSVQYSSTSSDRPVVkWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENG-SLLLSDLQLADEGTYEVE 123
Cdd:cd05775    1 GILGGSVTLPLNIPDGTEIESIT-WSFNTSLAIITPGEETAPEIIVTDPSYKERVNFSQNDySLQISNLKMEDAGSYRAE 79
                         90
                 ....*....|....*...
gi 121674801 124 ISITDDTFTgEKTINLTV 141
Cdd:cd05775   80 INTKNGVTI-TKEFTLHI 96
ig pfam00047
Immunoglobulin domain; Members of the immunoglobulin superfamily are found in hundreds of ...
161-219 7.19e-07

Immunoglobulin domain; Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.


Pssm-ID: 249539  Cd Length: 62  Bit Score: 46.38  E-value: 7.19e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 121674801  161 SEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPD---QKVLTITRVLMEDDDLYSCMV 219
Cdd:pfam00047   1 GSSVTLTCSVSGPPQVDVTWFKEGKGLEESTTVGTDTNrvsSITLTISNVTPEDSGTYTCVV 62
Ig3_NCAM-1_like cd05730
Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM); ...
160-221 7.75e-07

Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM); Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans interactions), through binding to the Ig1 and Ig2 domains. The adhesive ability of NCAM is modulated by the addition of polysialic acid chains to the fifth Ig-like domain.


Pssm-ID: 143207  Cd Length: 95  Bit Score: 46.85  E-value: 7.75e-07
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 121674801 160 LSEAFTLNCSHENGTKPSYTWLKDGKPLLN-DSRMLLSPDQKVLTITRVLMEDDDLYSCMVEN 221
Cdd:cd05730   17 LGQSVTLACDADGFPEPTMTWTKDGEPIESgEEKYSFNEDGSEMTILDVDKLDEAEYTCIAEN 79
Ig2_Robo cd05724
Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors; Ig2_Robo: domain ...
154-235 8.03e-07

Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors; Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagonizes slit responsiveness in precrossing axons. The Slit-Robo interaction is mediated by the second leucine-rich repeat (LRR) domain of Slit and the two N-terminal Ig domains of Robo, Ig1 and Ig2. The primary Robo binding site for Slit2 has been shown by surface plasmon resonance experiments and mutational analysis to be is the Ig1 domain, while the Ig2 domain has been proposed to harbor a weak secondary binding site.


Pssm-ID: 143201  Cd Length: 86  Bit Score: 46.62  E-value: 8.03e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801 154 STTVLELSEAFTLNCSHENGT-KPSYTWLKDGKPL-LNDSRMLLSPDQKvLTITRVLMEDDDLYSCMVENPISQGRSLPV 231
Cdd:cd05724    4 SDTQVAVGEMAVLECSPPRGHpEPTVSWRKDGQPLnLDNERVRIVDDGN-LLIAEARKSDEGTYKCVATNMVGERESAAA 82

                 ....
gi 121674801 232 KITV 235
Cdd:cd05724   83 RLSV 86
Ig5_Titin_like cd05747
M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins; ...
145-227 1.52e-05

M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins; Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.


Pssm-ID: 143224  Cd Length: 92  Bit Score: 42.73  E-value: 1.52e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801 145 ISRPQvlvaSTTVLElSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQ--KVLTITRVLMEDDDLYSCMVENp 222
Cdd:cd05747    7 LTKPR----SLTVSE-GESARFSCDVDGEPAPTVTWMREGQIIVSSQRHQITSTEykSTFEISKVQMSDEGNYTVVVEN- 80

                 ....*
gi 121674801 223 iSQGR 227
Cdd:cd05747   81 -SEGK 84
Ig1_Nectin-1_like cd05886
First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related ...
82-141 3.72e-05

First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins; Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is associated with cleft lip/palate ectodermal dysplasia syndrome (CLPED1). Nectin-1 is a major receptor for herpes simplex virus through interaction with the viral envelope glycoprotein D.


Pssm-ID: 143294  Cd Length: 99  Bit Score: 41.53  E-value: 3.72e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 121674801  82 SIGTEVIgtlrPDYRDRIRL----FENGSLLLSDLQLADEGTYEVEISiTDDTFTGEKTINLTV 141
Cdd:cd05886   40 SMGVSVL----PPYRERVTFknpsFEDGTISLSRLELEDEGVYICEFA-TFPTGNRESQLNLTV 98
Ig_1 cd05763
Subgroup of the immunoglobulin (Ig) superfamily; Ig_1: subgroup of the immunoglobulin (Ig) ...
166-221 4.87e-05

Subgroup of the immunoglobulin (Ig) superfamily; Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 143240  Cd Length: 75  Bit Score: 41.07  E-value: 4.87e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 121674801 166 LNCSHENGTKPSYTWLKDGK---PLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVEN 221
Cdd:cd05763    3 LECAATGHPTPQIAWQKDGGtdfPAARERRMHVMPEDDVFFIVDVKIEDTGVYSCTAQN 61
Ig_CSPGs_LP cd05714
Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage ...
33-134 5.94e-05

Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins; Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP). Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. There is considerable evidence that HA-binding CSPGs are involved in developmental processes in the central nervous system. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.


Pssm-ID: 143191  Cd Length: 106  Bit Score: 41.08  E-value: 5.94e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801  33 GVNITSPVRLIHgtvgksallsvQYSSTSSDRPVVKW---QLKRDKPVTVVQSIGteviGTLRPDYRDRIRLF------E 103
Cdd:cd05714    2 GGNVTLPCRFHL-----------EPALSAPHGPRIKWtklESDGAKEVDVLVAIG----GRVKVYGSGRVRVPlypadpG 66
                         90       100       110
                 ....*....|....*....|....*....|...
gi 121674801 104 NGSLLLSDLQLADEGTYEVEIS--ITDDTFTGE 134
Cdd:cd05714   67 DASLVITDLRLEDSGRYRCEVIdgIEDEQDTVE 99
Ig1_Robo cd07693
First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins; ...
154-228 7.85e-05

First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins; Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagonizes slit responsiveness in precrossing axons. The Slit-Robo interaction is mediated by the second leucine-rich repeat (LRR) domain of Slit and the two N-terminal Ig domains of Robo, Ig1 and Ig2. The primary Robo binding site for Slit2 has been shown by surface plasmon resonance experiments and mutational analysis to be is the Ig1 domain, while the Ig2 domain has been proposed to harbor a weak secondary binding site.


Pssm-ID: 143317  Cd Length: 100  Bit Score: 40.60  E-value: 7.85e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801 154 STTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLND-----SRMLLSPDQKVLTIT----RVLMEDDDLYSCMVENPIS 224
Cdd:cd07693    9 SDLIVSKGDPATLNCKAEGRPTPTIQWLKNGQPLETDkddprSHRIVLPSGSLFFLRvvhgRKGRSDEGVYVCVAHNSLG 88

                 ....
gi 121674801 225 QGRS 228
Cdd:cd07693   89 EAVS 92
Ig2_PTK7 cd05760
Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4; ...
165-225 9.21e-05

Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4; Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in several cancers, including melanoma and colon cancer lines.


Pssm-ID: 143237  Cd Length: 77  Bit Score: 40.28  E-value: 9.21e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 121674801 165 TLNCSHENGTKPSYTWLKDGKPLLND-SRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQ 225
Cdd:cd05760    2 TLRCHIDGHPRPTYQWFRDGTPLSDGqGNYSVSSKERTLTLRSAGPDDSGLYYCCAHNAFGS 63
Ig2_FGFR_like cd05729
Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar ...
166-221 1.16e-04

Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins; Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans. This group also contains fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.


Pssm-ID: 143206 [Multi-domain]  Cd Length: 85  Bit Score: 40.06  E-value: 1.16e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 121674801 166 LNCSHENGTKPSYTWLKDGKPLLNDSRM---LLSPDQKVLTITRVLMEDDDLYSCMVEN 221
Cdd:cd05729   14 LKCPASGNPRPTITWLKDGKPFKKEHRIggyKVRKKKWTLILESVVPSDSGKYTCIVEN 72
Ig4_Peroxidasin cd05746
Fourth immunoglobulin (Ig)-like domain of peroxidasin; Ig4_Peroxidasin: the fourth ...
166-223 1.66e-04

Fourth immunoglobulin (Ig)-like domain of peroxidasin; Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.


Pssm-ID: 143223  Cd Length: 69  Bit Score: 39.47  E-value: 1.66e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 121674801 166 LNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDqKVLTITRVLMEDDDLYSCMVENPI 223
Cdd:cd05746    3 IPCSAQGDPEPTITWNKDGVQVTESGKFHISPE-GYLAIRDVGVADQGRYECVARNTI 59
Ig1_PVR_like cd05718
First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar ...
92-141 3.01e-04

First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins; Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "canyon" with a footprint similar to that of the intercellular adhesion molecule-1 receptor on human rhinoviruses. This group also includes the first Ig-like domain of nectin-1 (also known as poliovirus receptor related protein(PVRL)1; CD111), nectin-3 (also known as PVRL 3), nectin-4 (also known as PVRL4; LNIR receptor)and DNAX accessory molecule 1 (DNAM-1; CD226).


Pssm-ID: 143195  Cd Length: 98  Bit Score: 38.87  E-value: 3.01e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 121674801  92 RPDYRDRIRL----FENGSLLLSDLQLADEGTYEVEISitddTF---TGEKTINLTV 141
Cdd:cd05718   45 PPSYEGRVSFlnssLEDATISISNLRLEDEGNYICEFA----TFpqgNRQKVTTLTV 97
Ig2_FGFR cd05857
Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor; Ig2_FGFR: ...
166-221 3.07e-04

Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor; Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.


Pssm-ID: 143265 [Multi-domain]  Cd Length: 85  Bit Score: 38.69  E-value: 3.07e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 121674801 166 LNCSHENGTKPSYTWLKDGKPLLNDSRM---LLSPDQKVLTITRVLMEDDDLYSCMVEN 221
Cdd:cd05857   14 FRCPAAGNPTPTMRWLKNGKEFKQEHRIggyKVRNQHWSLIMESVVPSDKGNYTCVVEN 72
Ig_CEACAM_D1 cd05774
First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion ...
82-141 4.97e-04

First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM); IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D1 Ig-like domain.


Pssm-ID: 143251  Cd Length: 105  Bit Score: 38.41  E-value: 4.97e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801  82 SIGTEVIgTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEIsITDDTFTGEKTINLTV 141
Cdd:cd05774   48 IISTNSS-TPGPAYSGRETIYPNGSLLIQNVTQKDTGFYTLQT-ITTNFQVEQATVHLQV 105
IgC_MHC_II_alpha cd05767
Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain; ...
148-220 1.01e-03

Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain; IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain. MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome before they are transported to the cell surface. MHC class II molecules are heterodimers, comprised of two similarly-sized membrane-spanning chains, alpha and beta. Each chain had two globular domains (N- and C-terminal), and a membrane-anchoring transmembrane segment. The two chains form a compact four-domain structure. The peptide-binding site is a cleft in the structure.


Pssm-ID: 143244  Cd Length: 94  Bit Score: 37.32  E-value: 1.01e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801 148 PQVLVASTTVLELSEAFTLNCSHENGTKP--SYTWLKDGKPL---LNDSRMLLSPDQKVLTITR--VLMEDDDLYSCMVE 220
Cdd:cd05767    2 PEVTVFSLKPVELGEPNTLICFVDNFFPPvlNVTWLKNGVPVtdgVSETRYYPRQDLSFQKFSYlnFTPEEGDIYSCIVE 81
Ig5_Contactin_like cd04969
Fifth Ig domain of contactin; Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins ...
168-221 1.15e-03

Fifth Ig domain of contactin; Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnatal, and a lack of contactin-5 (NB-2) results in an impairment of neuronal act ivity in the rat auditory system. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.


Pssm-ID: 143170  Cd Length: 73  Bit Score: 37.04  E-value: 1.15e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 121674801 168 CSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQ--KVLTITRvlmEDDDLYSCMVEN 221
Cdd:cd04969    8 CKPKAAPKPTISWSKGTELLTNSSRICIWPDGslEILNVTK---SDEGKYTCFAEN 60
Ig5_Contactin-1 cd05852
Fifth Ig domain of contactin-1; Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion ...
166-221 1.68e-03

Fifth Ig domain of contactin-1; Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.


Pssm-ID: 143260  Cd Length: 73  Bit Score: 36.54  E-value: 1.68e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 121674801 166 LNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKvLTITRVLMEDDDLYSCMVEN 221
Cdd:cd05852    6 IECKPKAAPKPKFSWSKGTELLVNNSRISIWDDGS-LEILNITKLDEGSYTCFAEN 60
IGv smart00406
Immunoglobulin V-Type;
50-120 1.85e-03

Immunoglobulin V-Type;


Pssm-ID: 214650  Cd Length: 81  Bit Score: 36.21  E-value: 1.85e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 121674801    50 SALLSVQYSSTSSDRPVVKWQLKR-DKPVTVVQSIGTEVIGTLRPDYRDRIRL-----FENGSLLLSDLQLADEGTY 120
Cdd:smart00406   1 SVTLSCKFSGSTFSSYYVSWVRQPpGKGLEWLGYIGSNGSSYYQESYKGRFTIskdtsKNDVSLTISNLRVEDTGTY 77
Ig_LP_like cd05877
Immunoglobulin (Ig)-like domain of human cartilage link protein (LP); Ig_LP_like: ...
33-134 2.56e-03

Immunoglobulin (Ig)-like domain of human cartilage link protein (LP); Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.


Pssm-ID: 143285  Cd Length: 106  Bit Score: 36.16  E-value: 2.56e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801  33 GVNITSPVRLIHgtvgKSALlsvqySSTSSDRpvVKW-QLKRD--KPVTVVQSIGT--EVIGtlrpDYRDRIRLFENG-- 105
Cdd:cd05877    2 GGNVTLPCRYHY----EPEL-----SAPRKIR--VKWtKLESDylKEEDVLVAIGTrhKSYG----SYQGRVFLRRAHdl 66
                         90       100       110
                 ....*....|....*....|....*....|...
gi 121674801 106 --SLLLSDLQLADEGTYEVEIS--ITDDTFTGE 134
Cdd:cd05877   67 daSLVITDLRLEDYGRYRCEVIdgLEDESVVVA 99
Ig_pIgR cd05716
Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR); Ig_pIgR: Immunoglobulin ...
155-234 3.37e-03

Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR); Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.


Pssm-ID: 143193  Cd Length: 98  Bit Score: 35.50  E-value: 3.37e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801 155 TTVLELSEAFTLNCSHeNGTKPSYT--WLKDGKPLLND-------------SRMLLSPDQK----VLTITRVLMEDDDLY 215
Cdd:cd05716    1 VVTGELGGSVTIPCPY-PPKNRSYEkyWCKWGSAGCCLiivsegsvqsqyeGRVSLTDDPDngvfTVTLNQLRKEDAGWY 79
                         90
                 ....*....|....*....
gi 121674801 216 SCMVENPISQGRSLPVKIT 234
Cdd:cd05716   80 WCGVGDDGDQGLTLSVTLV 98
Ig5_NCAM-1 cd05869
Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM); ...
146-225 3.56e-03

Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM); Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans interactions), through binding to the Ig1 and Ig2 domains. The adhesive ability of NCAM is modulated by the addition of polysialic acid chains to the fifth Ig-like domain.


Pssm-ID: 143277  Cd Length: 97  Bit Score: 35.73  E-value: 3.56e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801 146 SRPQV-LVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLN-----DSRMLLSPDQKV--LTITRVLMEDDDLYSC 217
Cdd:cd05869    1 AKPKItYVENQTAMELEEQITLTCEASGDPIPSITWRTSTRNISSeektlDGHIVVRSHARVssLTLKYIQYTDAGEYLC 80

                 ....*...
gi 121674801 218 MVENPISQ 225
Cdd:cd05869   81 TASNTIGQ 88
Ig_Myomesin_like_C cd05737
C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein; Ig_Myomesin_like_C: ...
156-221 4.09e-03

C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein; Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.


Pssm-ID: 143214  Cd Length: 92  Bit Score: 35.18  E-value: 4.09e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 121674801 156 TVLElSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQ---KVLTITRVLMEDDDLYSCMVEN 221
Cdd:cd05737   12 TIME-GKTLNLTCTVFGDPDPEVSWLKNDQALALSDHYNVKVEQgkyASLTIKGVSSEDSGKYGIVVKN 79
Ig3_L1-CAM_like cd05731
Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM); Ig3_L1-CAM_like: ...
165-222 5.80e-03

Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM); Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.


Pssm-ID: 143208  Cd Length: 71  Bit Score: 34.65  E-value: 5.80e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 121674801 165 TLNCSHENGTKPSYTWLKDGKPLLNDsRMLLSPDQKVLTITRVLMEDDDLYSCMVENP 222
Cdd:cd05731    2 LLECIAEGLPTPEISWIKIGGELPAD-RTKFENFNKTLKIDNVSEEDDGEYRCTASNS 58
Ig_P0-like cd05715
Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins; Ig_P0ex-like: ...
41-120 8.83e-03

Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins; Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 (SCN2B), and of epithelial V-like antigen 1 (EVA). EVA, also known as myelin protein zero-like 2, is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development. SCN2B subunits play a role in determining sodium channel density and function in neurons,and in control of electrical excitability in the brain.


Pssm-ID: 143192  Cd Length: 116  Bit Score: 34.62  E-value: 8.83e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801  41 RLIHGTVGKSALLSVQYSSTS--SDRPVVKWQLKRDKPVTVV----QSIGTEVIGTLRPdYRDRIRLFEN-----GSLLL 109
Cdd:cd05715    6 REVYAVNGSDVRLKCTFSSSEpiSDDISVTWSFQPEGSGDTEsifhYHKGPYYPLKDGR-FKDRVEWVGNpsrkdASIVI 84
                         90
                 ....*....|.
gi 121674801 110 SDLQLADEGTY 120
Cdd:cd05715   85 HNLQFTDNGTY 95
Ig3_Peroxidasin cd05745
Third immunoglobulin (Ig)-like domain of peroxidasin; Ig3_Peroxidasin: the third ...
168-227 9.36e-03

Third immunoglobulin (Ig)-like domain of peroxidasin; Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.


Pssm-ID: 143222  Cd Length: 74  Bit Score: 34.14  E-value: 9.36e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 121674801 168 CSHENGTKPSYTWLKDGKPLLNDSR-MLLSpdQKVLTITRVLMEDDDLYSCMVENPISQGR 227
Cdd:cd05745    9 CEAQGYPQPVIAWTKGGSQLSVDRRhLVLS--SGTLRISRVALHDQGQYECQAVNIVGSQR 67
IGc2 smart00408
Immunoglobulin C-2 Type;
162-224 1.87e-10

Immunoglobulin C-2 Type;


Pssm-ID: 197706 [Multi-domain]  Cd Length: 63  Bit Score: 56.65  E-value: 1.87e-10
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 121674801   162 EAFTLNCSHENGTKPSYTWLKDGKPLlnDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPIS 224
Cdd:smart00408   3 QSVTLTCPAEGNPVPNITWLKDGKPL--PESNRFVASGSTLTIKSVSLEDSGLYTCVAENSAG 63
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
43-141 3.25e-05

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653 [Multi-domain]  Cd Length: 85  Bit Score: 41.72  E-value: 3.25e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801    43 IHGTVGKSALLSVQYSSTSSdrPVVKWQLKRDKPVTvvqsigtevigtlrpdYRDRIRLFENG---SLLLSDLQLADEGT 119
Cdd:smart00410   4 VTVKEGESVTLSCEASGSPP--PEVTWYKQGGKLLA----------------ESGRFSVSRSGstsTLTISNVTPEDSGT 65
                           90       100
                   ....*....|....*....|..
gi 121674801   120 YevEISITDDTFTGEKTINLTV 141
Cdd:smart00410  66 Y--TCAATNSSGSASSGTTLTV 85
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
154-235 1.50e-09

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653 [Multi-domain]  Cd Length: 85  Bit Score: 54.43  E-value: 1.50e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801   154 STTVLElSEAFTLNCSHENGTKPSYTWLKDG-KPLLNDSRMLLSPD--QKVLTITRVLMEDDDLYSCMVENPISQGRSlP 230
Cdd:smart00410   3 SVTVKE-GESVTLSCEASGSPPPEVTWYKQGgKLLAESGRFSVSRSgsTSTLTISNVTPEDSGTYTCAATNSSGSASS-G 80

                   ....*
gi 121674801   231 VKITV 235
Cdd:smart00410  81 TTLTV 85
IG smart00409
Immunoglobulin;
154-235 1.50e-09

Immunoglobulin;


Pssm-ID: 214652 [Multi-domain]  Cd Length: 85  Bit Score: 54.43  E-value: 1.50e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801   154 STTVLElSEAFTLNCSHENGTKPSYTWLKDG-KPLLNDSRMLLSPD--QKVLTITRVLMEDDDLYSCMVENPISQGRSlP 230
Cdd:smart00409   3 SVTVKE-GESVTLSCEASGSPPPEVTWYKQGgKLLAESGRFSVSRSgsTSTLTISNVTPEDSGTYTCAATNSSGSASS-G 80

                   ....*
gi 121674801   231 VKITV 235
Cdd:smart00409  81 TTLTV 85
I-set pfam07679
Immunoglobulin I-set domain;
175-225 2.77e-06

Immunoglobulin I-set domain;


Pssm-ID: 254352 [Multi-domain]  Cd Length: 90  Bit Score: 44.94  E-value: 2.77e-06
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 121674801  175 KPSYTWLKDGKPLLNDSRMLLSPDQKV--LTITRVLMEDDDLYSCMVENPISQ 225
Cdd:pfam07679  29 DPEVSWFKDGQPLRSSDRFKVTYEGGTytLTISNVQPDDSGKYTCVATNSAGE 81
IG smart00409
Immunoglobulin;
43-141 3.25e-05

Immunoglobulin;


Pssm-ID: 214652 [Multi-domain]  Cd Length: 85  Bit Score: 41.72  E-value: 3.25e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801    43 IHGTVGKSALLSVQYSSTSSdrPVVKWQLKRDKPVTvvqsigtevigtlrpdYRDRIRLFENG---SLLLSDLQLADEGT 119
Cdd:smart00409   4 VTVKEGESVTLSCEASGSPP--PEVTWYKQGGKLLA----------------ESGRFSVSRSGstsTLTISNVTPEDSGT 65
                           90       100
                   ....*....|....*....|..
gi 121674801   120 YevEISITDDTFTGEKTINLTV 141
Cdd:smart00409  66 Y--TCAATNSSGSASSGTTLTV 85
PHA03247 PHA03247
large tegument protein UL36; Provisional
315-399 6.58e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 40.69  E-value: 6.58e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801  315 DKDSPETEENPAPEPRSATEPGPPGYSVSPAvpGRSPGLPIRSARRYPRSPARSPATGRTHsspprapsspgRSRSASRT 394
Cdd:PHA03247 2604 DRGDPRGPAPPSPLPPDTHAPDPPPPSPSPA--ANEPDPHPPPTVPPPERPRDDPAPGRVS-----------RPRRARRL 2670

                  ....*
gi 121674801  395 LRTAG 399
Cdd:PHA03247 2671 GRAAQ 2675
PHA02826 PHA02826
IL-1 receptor-like protein; Provisional
103-217 1.66e-03

IL-1 receptor-like protein; Provisional


Pssm-ID: 165173 [Multi-domain]  Cd Length: 227  Bit Score: 38.36  E-value: 1.66e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121674801 103 ENGS----LLLSDLQLADEGTYEVEISitDDTFTGEKTINLTVDvpisrpqvlvASTTVLELSEAF--TLNCSHENGTKP 176
Cdd:PHA02826  92 EIGDrsenLWIGNVINIDEGIYICTIS--SGNICEESTIRLTFD----------SGTINYQFNSGKdsKLHCYGTDGISS 159
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 121674801 177 SY-----TWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSC 217
Cdd:PHA02826 160 TFkdytlTWYKNGNIVLYTDRIQLRNNNSTLVIKSATHDDSGIYTC 205
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH