NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|11496927|ref|NP_045688|]
View 

outer surface protein A [Borrelia burgdorferi B31]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Lipoprotein_1 super family cl20135
Borrelia lipoprotein; This family of lipoproteins is found in Borrelia spirochetes. The ...
21-273 3.99e-95

Borrelia lipoprotein; This family of lipoproteins is found in Borrelia spirochetes. The function of these proteins is uncertain.


The actual alignment was detected with superfamily member pfam00820:

Pssm-ID: 189730  Cd Length: 253  Bit Score: 283.33  E-value: 3.99e-95
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496927    21 VSSLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLE 100
Cdd:pfam00820   1 VSSLDEKNSVSVDLPGEMEVLVSKEKNKDGKYSLRATVDTVELKGTSDKNNGSGVLEGEKADKSKVKLTISDDLNTITFE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496927   101 VFKEDGkTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSD-GSGKAKEVLK-GYVLEGTLTAEKTTL 178
Cdd:pfam00820  81 TFKEDG-TKVSRKVFSKDKSLTEEKFNEKGKLSEKKLTRTNGTTLEYSDMTNDeNATKAVETLKnGITLEGNLAGGKTTL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496927   179 VVKEGTVTLSKNISKSGEVSVELNDTdSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGS 258
Cdd:pfam00820 160 EIKEGTVTLSKEIDKSGKVTVALNDT-TSSSSKKTASWDDKTSTLTISANSKKTKDLVFTKEGTITVQNYDSAGTNLEGT 238
                         250
                  ....*....|....*
gi 11496927   259 AVEITKLDEIKNALK 273
Cdd:pfam00820 239 AVEIKTLDELKAALK 253
 
Name Accession Description Interval E-value
Lipoprotein_1 pfam00820
Borrelia lipoprotein; This family of lipoproteins is found in Borrelia spirochetes. The ...
21-273 3.99e-95

Borrelia lipoprotein; This family of lipoproteins is found in Borrelia spirochetes. The function of these proteins is uncertain.


Pssm-ID: 189730  Cd Length: 253  Bit Score: 283.33  E-value: 3.99e-95
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496927    21 VSSLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLE 100
Cdd:pfam00820   1 VSSLDEKNSVSVDLPGEMEVLVSKEKNKDGKYSLRATVDTVELKGTSDKNNGSGVLEGEKADKSKVKLTISDDLNTITFE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496927   101 VFKEDGkTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSD-GSGKAKEVLK-GYVLEGTLTAEKTTL 178
Cdd:pfam00820  81 TFKEDG-TKVSRKVFSKDKSLTEEKFNEKGKLSEKKLTRTNGTTLEYSDMTNDeNATKAVETLKnGITLEGNLAGGKTTL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496927   179 VVKEGTVTLSKNISKSGEVSVELNDTdSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGS 258
Cdd:pfam00820 160 EIKEGTVTLSKEIDKSGKVTVALNDT-TSSSSKKTASWDDKTSTLTISANSKKTKDLVFTKEGTITVQNYDSAGTNLEGT 238
                         250
                  ....*....|....*
gi 11496927   259 AVEITKLDEIKNALK 273
Cdd:pfam00820 239 AVEIKTLDELKAALK 253
 
Name Accession Description Interval E-value
Lipoprotein_1 pfam00820
Borrelia lipoprotein; This family of lipoproteins is found in Borrelia spirochetes. The ...
21-273 3.99e-95

Borrelia lipoprotein; This family of lipoproteins is found in Borrelia spirochetes. The function of these proteins is uncertain.


Pssm-ID: 189730  Cd Length: 253  Bit Score: 283.33  E-value: 3.99e-95
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496927    21 VSSLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLE 100
Cdd:pfam00820   1 VSSLDEKNSVSVDLPGEMEVLVSKEKNKDGKYSLRATVDTVELKGTSDKNNGSGVLEGEKADKSKVKLTISDDLNTITFE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496927   101 VFKEDGkTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSD-GSGKAKEVLK-GYVLEGTLTAEKTTL 178
Cdd:pfam00820  81 TFKEDG-TKVSRKVFSKDKSLTEEKFNEKGKLSEKKLTRTNGTTLEYSDMTNDeNATKAVETLKnGITLEGNLAGGKTTL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496927   179 VVKEGTVTLSKNISKSGEVSVELNDTdSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGS 258
Cdd:pfam00820 160 EIKEGTVTLSKEIDKSGKVTVALNDT-TSSSSKKTASWDDKTSTLTISANSKKTKDLVFTKEGTITVQNYDSAGTNLEGT 238
                         250
                  ....*....|....*
gi 11496927   259 AVEITKLDEIKNALK 273
Cdd:pfam00820 239 AVEIKTLDELKAALK 253
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH