NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|6754520|ref|NP_034827|]
View 

LIM domain-binding protein 1 isoform 3 [Mus musculus]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
LIM_bind pfam01803
LIM-domain binding protein; The LIM-domain binding protein, binds to the LIM domain pfam00412 ...
33-236 5.59e-73

LIM-domain binding protein; The LIM-domain binding protein, binds to the LIM domain pfam00412 of LIM homeodomain proteins which are transcriptional regulators of development. Nuclear LIM interactor (NLI) / LIM domain-binding protein 1 (LDB1) is located in the nuclei of neuronal cells during development, it is co-expressed with Isl1 in early motor neuron differentiation and has a suggested role in the Isl1 dependent development of motor neurons. It is suggested that these proteins act synergistically to enhance transcriptional efficiency by acting as co-factors for LIM homeodomain and Otx class transcription factors both of which have essential roles in development. The Drosophila protein Chip is required for segmentation and activity of a remote wing margin enhancer. Chip is a ubiquitous chromosomal factor required for normal expression of diverse genes at many stages of development. It is suggested that Chip cooperates with different LIM domain proteins and other factors to structurally support remote enhancer-promoter interactions.


:

Pssm-ID: 250879  Cd Length: 232  Bit Score: 229.47  E-value: 5.59e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754520     33 YRIFELNKRLQN-WTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGP--KRYTIGRTLIPRYFRSIFEGGATELYYVLKH 109
Cdd:pfam01803   2 LRLLEFNEHLSNfRGEDDDISYWQRFVHEFFSPDAVLRYSLSSEDGPegKQFEITTPALPRYFRTLFESGVKRMQLVLEG 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754520    110 PKE-AFHSNFVSLDCDQGSMVTQHGKPMftQVCVEGRLYLEFmfDDMMRIKTWHFSIRQHRELIPRSILAMHA------- 181
Cdd:pfam01803  82 AREqVLPNGGIFVECPRASFIYWYDDGS--QVVTEGTLRAHF--DPDLKIEWWDFCTRSHEEYIPRSVLEPLAsplpnav 157
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 6754520    182 ------QDPQMLDQL-------------SKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYS-LSPRDCLKT 236
Cdd:pfam01803 158 ksgqqsPELSKNSQLrqqkgpqpitslpSSNVTRFGLPKAVMRFLEIAEVLSPMKDLMSFSKANPiLSPREALKQ 232
 
Name Accession Description Interval E-value
LIM_bind pfam01803
LIM-domain binding protein; The LIM-domain binding protein, binds to the LIM domain pfam00412 ...
33-236 5.59e-73

LIM-domain binding protein; The LIM-domain binding protein, binds to the LIM domain pfam00412 of LIM homeodomain proteins which are transcriptional regulators of development. Nuclear LIM interactor (NLI) / LIM domain-binding protein 1 (LDB1) is located in the nuclei of neuronal cells during development, it is co-expressed with Isl1 in early motor neuron differentiation and has a suggested role in the Isl1 dependent development of motor neurons. It is suggested that these proteins act synergistically to enhance transcriptional efficiency by acting as co-factors for LIM homeodomain and Otx class transcription factors both of which have essential roles in development. The Drosophila protein Chip is required for segmentation and activity of a remote wing margin enhancer. Chip is a ubiquitous chromosomal factor required for normal expression of diverse genes at many stages of development. It is suggested that Chip cooperates with different LIM domain proteins and other factors to structurally support remote enhancer-promoter interactions.


Pssm-ID: 250879  Cd Length: 232  Bit Score: 229.47  E-value: 5.59e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754520     33 YRIFELNKRLQN-WTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGP--KRYTIGRTLIPRYFRSIFEGGATELYYVLKH 109
Cdd:pfam01803   2 LRLLEFNEHLSNfRGEDDDISYWQRFVHEFFSPDAVLRYSLSSEDGPegKQFEITTPALPRYFRTLFESGVKRMQLVLEG 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754520    110 PKE-AFHSNFVSLDCDQGSMVTQHGKPMftQVCVEGRLYLEFmfDDMMRIKTWHFSIRQHRELIPRSILAMHA------- 181
Cdd:pfam01803  82 AREqVLPNGGIFVECPRASFIYWYDDGS--QVVTEGTLRAHF--DPDLKIEWWDFCTRSHEEYIPRSVLEPLAsplpnav 157
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 6754520    182 ------QDPQMLDQL-------------SKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYS-LSPRDCLKT 236
Cdd:pfam01803 158 ksgqqsPELSKNSQLrqqkgpqpitslpSSNVTRFGLPKAVMRFLEIAEVLSPMKDLMSFSKANPiLSPREALKQ 232
 
Name Accession Description Interval E-value
LIM_bind pfam01803
LIM-domain binding protein; The LIM-domain binding protein, binds to the LIM domain pfam00412 ...
33-236 5.59e-73

LIM-domain binding protein; The LIM-domain binding protein, binds to the LIM domain pfam00412 of LIM homeodomain proteins which are transcriptional regulators of development. Nuclear LIM interactor (NLI) / LIM domain-binding protein 1 (LDB1) is located in the nuclei of neuronal cells during development, it is co-expressed with Isl1 in early motor neuron differentiation and has a suggested role in the Isl1 dependent development of motor neurons. It is suggested that these proteins act synergistically to enhance transcriptional efficiency by acting as co-factors for LIM homeodomain and Otx class transcription factors both of which have essential roles in development. The Drosophila protein Chip is required for segmentation and activity of a remote wing margin enhancer. Chip is a ubiquitous chromosomal factor required for normal expression of diverse genes at many stages of development. It is suggested that Chip cooperates with different LIM domain proteins and other factors to structurally support remote enhancer-promoter interactions.


Pssm-ID: 250879  Cd Length: 232  Bit Score: 229.47  E-value: 5.59e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754520     33 YRIFELNKRLQN-WTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGP--KRYTIGRTLIPRYFRSIFEGGATELYYVLKH 109
Cdd:pfam01803   2 LRLLEFNEHLSNfRGEDDDISYWQRFVHEFFSPDAVLRYSLSSEDGPegKQFEITTPALPRYFRTLFESGVKRMQLVLEG 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6754520    110 PKE-AFHSNFVSLDCDQGSMVTQHGKPMftQVCVEGRLYLEFmfDDMMRIKTWHFSIRQHRELIPRSILAMHA------- 181
Cdd:pfam01803  82 AREqVLPNGGIFVECPRASFIYWYDDGS--QVVTEGTLRAHF--DPDLKIEWWDFCTRSHEEYIPRSVLEPLAsplpnav 157
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 6754520    182 ------QDPQMLDQL-------------SKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYS-LSPRDCLKT 236
Cdd:pfam01803 158 ksgqqsPELSKNSQLrqqkgpqpitslpSSNVTRFGLPKAVMRFLEIAEVLSPMKDLMSFSKANPiLSPREALKQ 232
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH