NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|33356547|ref|NP_004517|]
View 

DNA replication licensing factor MCM2 [Homo sapiens]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
518-664 1.57e-04

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


:

Pssm-ID: 99707  Cd Length: 151  Bit Score: 41.75  E-value: 1.57e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 518 NVLLCGDPGTAKSQFLKYIEKVSSRAIFTT-GQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQD 596
Cdd:cd00009  21 NLLLYGPPGTGKTTLARAIANELFRPGAPFlYLNASDLLEGLVVAELFGHFLVRLLFELAEKAKPGVLFIDEIDSLSRGA 100
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 33356547 597 RTSIHEAMEQQSISISKagivtslQARCTVIAAANPiggrydpsltfSENVDLTEPIISRFDILCVVR 664
Cdd:cd00009 101 QNALLRVLETLNDLRID-------RENVRVIGATNR-----------PLLGDLDRALYDRLDIRIVIP 150
MCM2_N pfam12619
Mini-chromosome maintenance protein 2; This domain family is found in eukaryotes, and is ...
73-182 7.06e-27

Mini-chromosome maintenance protein 2; This domain family is found in eukaryotes, and is typically between 138 and 153 amino acids in length. The family is found in association with pfam00493. Mini-chromosome maintenance (MCM) proteins are essential for DNA replication. These proteins use ATPase activity to perform this function.


:

Pssm-ID: 257167  Cd Length: 145  Bit Score: 108.20  E-value: 7.06e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    73 IGDGMERDYRAIPELDAYEAEGLaLDDEDVEELTASQREAAERAMRQRDREAgrgLGRMRRGLLYDSDEEDEE------R 146
Cdd:pfam12619  31 FGDNMERDYRANPELDRYDEDGL-DDESDYEELSAAARRAAEARLNRRDRLL---RRRRMPAAFLDDDDEDDGdfdltaQ 106
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 33356547   147 PARKRRQVERATEDGEEDEEMIE---SIENLEDLKGHSV 182
Cdd:pfam12619 107 PRRRRRQYDEDRDADDEDIDPLEeelSLEDLSDVKAASI 145
MCM_N pfam14551
MCM N-terminal domain; This family contains the N-terminal region of MCM proteins. This region ...
195-310 3.14e-26

MCM N-terminal domain; This family contains the N-terminal region of MCM proteins. This region is composed of three structural domains. Firstly a four helical bundle, secondly a zinc binding motif and thirdly an OB-like fold.


:

Pssm-ID: 258689  Cd Length: 117  Bit Score: 105.38  E-value: 3.14e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   195 IHHRFKNFLRTHVDShGHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKY 274
Cdd:pfam14551   1 IKRRFREFLREFKGG-GEPKYRDQLREMANREKRSLEVDLDDLREFDPELADALLENPQEYLPLFEEALKEVVLELDPFP 79
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 33356547   275 DRITNH--IHVRISHLPLVEELRSLRQLHLNQLIRTSG 310
Cdd:pfam14551  80 PELKRRkeIQVRFYNLPKVVSIRDLRSSHIGKLVSVEG 117
MCM smart00350
minichromosome maintenance proteins;
291-803 0e+00

minichromosome maintenance proteins;


:

Pssm-ID: 214631 [Multi-domain]  Cd Length: 509  Bit Score: 818.04  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    291 VEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSqNQEVKPGSCP--ECQSAGPFEVNMEET 368
Cdd:smart00350   2 PSSIRELRADHLGKLVRISGIVTRTSGVRPKLKRASFTCEKCGATLGPEIQS-GRETEPTVCPprECQSPTPFSLNHERS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    369 IYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNN-YDGSLNTANGFPVFATVILANHVAKK 447
Cdd:smart00350  81 TFIDFQKIKLQESPEEVPVGQLPRSVDVILDGDLVDKAKPGDRVEVTGIYRNVpYGFKLNTVKGLPVFATYIEANHVRKL 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    448 DNKVA-------VGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVL 520
Cdd:smart00350 161 DYKRSfedssfsVQSLSDEEEEEIRKLSKDPDIYERLARSLAPSIYGHEDIKKAILLLLFGGVHKNLPDGMKIRGDINIL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    521 LCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI 600
Cdd:smart00350 241 LCGDPGTAKSQLLKYVEKTAPRAVYTTGKGSSAVGLTAAVTRDPETREFTLEAGALVLADNGVCCIDEFDKMDDSDRTAI 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    601 HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVV 680
Cdd:smart00350 321 HEAMEQQTISIAKAGITTTLNARCSVLAAANPIGGRYDPKLTPEENIDLPAPILSRFDLLFVVLDEVDEERDRELAKHVV 400
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    681 GSHVRHHPSNKEEEGlangsaaepampntygvEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMAT--- 757
Cdd:smart00350 401 DLHRYSHPEEDEAFE-----------------PPLSQEKLRKYIAYAREKIKPKLSEEAADKLVKAYVDLRKEDSQTesr 463
                          490       500       510       520
                   ....*....|....*....|....*....|....*....|....*.
gi 33356547    758 GSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFI 803
Cdd:smart00350 464 SSIPITVRQLESIIRLSEAHAKMRLSDVVEEADVEEAIRLLRESII 509
 
Name Accession Description Interval E-value
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
518-664 1.57e-04

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707  Cd Length: 151  Bit Score: 41.75  E-value: 1.57e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 518 NVLLCGDPGTAKSQFLKYIEKVSSRAIFTT-GQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQD 596
Cdd:cd00009  21 NLLLYGPPGTGKTTLARAIANELFRPGAPFlYLNASDLLEGLVVAELFGHFLVRLLFELAEKAKPGVLFIDEIDSLSRGA 100
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 33356547 597 RTSIHEAMEQQSISISKagivtslQARCTVIAAANPiggrydpsltfSENVDLTEPIISRFDILCVVR 664
Cdd:cd00009 101 QNALLRVLETLNDLRID-------RENVRVIGATNR-----------PLLGDLDRALYDRLDIRIVIP 150
MCM2_N pfam12619
Mini-chromosome maintenance protein 2; This domain family is found in eukaryotes, and is ...
73-182 7.06e-27

Mini-chromosome maintenance protein 2; This domain family is found in eukaryotes, and is typically between 138 and 153 amino acids in length. The family is found in association with pfam00493. Mini-chromosome maintenance (MCM) proteins are essential for DNA replication. These proteins use ATPase activity to perform this function.


Pssm-ID: 257167  Cd Length: 145  Bit Score: 108.20  E-value: 7.06e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    73 IGDGMERDYRAIPELDAYEAEGLaLDDEDVEELTASQREAAERAMRQRDREAgrgLGRMRRGLLYDSDEEDEE------R 146
Cdd:pfam12619  31 FGDNMERDYRANPELDRYDEDGL-DDESDYEELSAAARRAAEARLNRRDRLL---RRRRMPAAFLDDDDEDDGdfdltaQ 106
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 33356547   147 PARKRRQVERATEDGEEDEEMIE---SIENLEDLKGHSV 182
Cdd:pfam12619 107 PRRRRRQYDEDRDADDEDIDPLEeelSLEDLSDVKAASI 145
MCM_N pfam14551
MCM N-terminal domain; This family contains the N-terminal region of MCM proteins. This region ...
195-310 3.14e-26

MCM N-terminal domain; This family contains the N-terminal region of MCM proteins. This region is composed of three structural domains. Firstly a four helical bundle, secondly a zinc binding motif and thirdly an OB-like fold.


Pssm-ID: 258689  Cd Length: 117  Bit Score: 105.38  E-value: 3.14e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   195 IHHRFKNFLRTHVDShGHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKY 274
Cdd:pfam14551   1 IKRRFREFLREFKGG-GEPKYRDQLREMANREKRSLEVDLDDLREFDPELADALLENPQEYLPLFEEALKEVVLELDPFP 79
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 33356547   275 DRITNH--IHVRISHLPLVEELRSLRQLHLNQLIRTSG 310
Cdd:pfam14551  80 PELKRRkeIQVRFYNLPKVVSIRDLRSSHIGKLVSVEG 117
Mg_chelatase pfam01078
Magnesium chelatase, subunit ChlI; Magnesium-chelatase is a three-component enzyme that ...
485-659 4.16e-06

Magnesium chelatase, subunit ChlI; Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa.


Pssm-ID: 144608  Cd Length: 207  Bit Score: 47.12  E-value: 4.16e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   485 IYGHEDIKRGLALALFGGepknpggkHkvrgdiNVLLCGDPGTAKS---QFLKYI-------EKVSSRAIfttgqgASAV 554
Cdd:pfam01078   5 VKGQEQAKRALEIAAAGG--------H------NLLMIGPPGSGKTmlaKRLPGIlpplteqEALEVTAI------HSVA 64
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   555 GLTAyvQRHPVSR------EWTLEAGALV------------LADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGI 616
Cdd:pfam01078  65 GLGG--DGGLIRRrpfrapHHSASAAALVgggsiprpgeisLAHNGVLFLDELPEFSRRVLESLRQPLEDGEITISRARA 142
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|...
gi 33356547   617 VTSLQARCTVIAAANP--IGGRYDPSLTFSENVD--------LTEPIISRFDI 659
Cdd:pfam01078 143 KVTFPARFQLVAAMNPcpCGYLGDPDKRCRCTPRqirrylsrLSGPLLDRIDL 195
MCM smart00350
minichromosome maintenance proteins;
291-803 0e+00

minichromosome maintenance proteins;


Pssm-ID: 214631 [Multi-domain]  Cd Length: 509  Bit Score: 818.04  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    291 VEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSqNQEVKPGSCP--ECQSAGPFEVNMEET 368
Cdd:smart00350   2 PSSIRELRADHLGKLVRISGIVTRTSGVRPKLKRASFTCEKCGATLGPEIQS-GRETEPTVCPprECQSPTPFSLNHERS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    369 IYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNN-YDGSLNTANGFPVFATVILANHVAKK 447
Cdd:smart00350  81 TFIDFQKIKLQESPEEVPVGQLPRSVDVILDGDLVDKAKPGDRVEVTGIYRNVpYGFKLNTVKGLPVFATYIEANHVRKL 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    448 DNKVA-------VGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVL 520
Cdd:smart00350 161 DYKRSfedssfsVQSLSDEEEEEIRKLSKDPDIYERLARSLAPSIYGHEDIKKAILLLLFGGVHKNLPDGMKIRGDINIL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    521 LCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI 600
Cdd:smart00350 241 LCGDPGTAKSQLLKYVEKTAPRAVYTTGKGSSAVGLTAAVTRDPETREFTLEAGALVLADNGVCCIDEFDKMDDSDRTAI 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    601 HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVV 680
Cdd:smart00350 321 HEAMEQQTISIAKAGITTTLNARCSVLAAANPIGGRYDPKLTPEENIDLPAPILSRFDLLFVVLDEVDEERDRELAKHVV 400
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    681 GSHVRHHPSNKEEEGlangsaaepampntygvEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMAT--- 757
Cdd:smart00350 401 DLHRYSHPEEDEAFE-----------------PPLSQEKLRKYIAYAREKIKPKLSEEAADKLVKAYVDLRKEDSQTesr 463
                          490       500       510       520
                   ....*....|....*....|....*....|....*....|....*.
gi 33356547    758 GSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFI 803
Cdd:smart00350 464 SSIPITVRQLESIIRLSEAHAKMRLSDVVEEADVEEAIRLLRESII 509
MCM2 COG1241
Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, ...
213-840 0e+00

Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]


Pssm-ID: 224162 [Multi-domain]  Cd Length: 682  Bit Score: 644.01  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 213 NVFKERIsDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVE 292
Cdd:COG1241  17 LEYAENI-ILDKIINRSLEVDLSDLEEYDPELAGLLLENPEEIIPLFEKALDEIALLLFPEVDRSLKKIHVRFKNLPNRL 95
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 293 ELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFcQSQNQEVKPGSCPECQSA--GPFEVNMEETIY 370
Cdd:COG1241  96 SIRELRSEHIGKLVSVEGIVTRASEVRPRLKKAVFECPKCGREVEVE-QSEFRVEPPRECENCGKFgkGPLKLVPRKSEF 174
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 371 QNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVaKKDNK 450
Cdd:COG1241 175 IDFQKVKIQELPELVPGGELPRSIEVILEDDLVDSVRPGDRVKITGVVRIVPSRSLSGRRKGPVFEIYLEANSV-EKLDK 253
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 451 VAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKS 530
Cdd:COG1241 254 REEVEITEEDEEEIKELAKRPDIYDILIKSIAPSIYGHEDVKKAILLQLFGGVKKNLPDGTRIRGDIHILLVGDPGTAKS 333
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 531 QFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSIS 610
Cdd:COG1241 334 QLLKYVAKLAPRGVYTSGKGSSAAGLTAAVVRDKVTGEWVLEAGALVLADGGVCCIDEFDKMNEEDRVAIHEAMEQQTIS 413
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 611 ISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSN 690
Cdd:COG1241 414 IAKAGITATLNARCSVLAAANPKFGRYDPKKTVAENINLPAPLLSRFDLIFVLKDDPDEEKDEEIAEHILDKHRGEEPEE 493
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 691 KEEEglangsaaepamPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESM---ATGSIPITVRHI 767
Cdd:COG1241 494 TISL------------DGVDEVEERDFELLRKYISYARKNVTPVLTEEAREELEDYYVEMRKKSAlveEKRTIPITARQL 561
                       570       580       590       600       610       620       630
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 33356547 768 ESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLES----FIDTQKFSVMRSMRKTFARYlsFRRDNNELLLFILKQLV 840
Cdd:COG1241 562 ESIIRLAEAHAKMRLSDVVEEEDVDEAIRLVDFSlktvAVDPEKGKIDIDIIEPGKSK--SKRDKIEKVLDIIKELV 636
MCM pfam00493
MCM2/3/5 family;
460-803 0e+00

MCM2/3/5 family;


Pssm-ID: 249903 [Multi-domain]  Cd Length: 330  Bit Score: 547.16  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   460 DVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKV 539
Cdd:pfam00493   1 DEEEIKELAKDPDIYDKLARSIAPSIYGHEDVKKAILLQLFGGVKKNTPDGTRLRGDINVLLVGDPGTAKSQLLKYVAKL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   540 SSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTS 619
Cdd:pfam00493  81 APRAVYTSGKGSSAAGLTAAVVRDPDTGEWTLEAGALVLADGGVCCIDEFDKMNEEDRVAIHEAMEQQTISIAKAGIVAT 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   620 LQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGlang 699
Cdd:pfam00493 161 LNARCSVLAAANPIFGRYDPKKSVAENINLPPPLLSRFDLIFVLLDKPDEEKDERLAKHIVDLHRNGEPSVEESIE---- 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   700 saaepampntyGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESM-ATGSIPITVRHIESMIRMAEAHA 778
Cdd:pfam00493 237 -----------TEDYVDPELLRKYIAYARENIFPKLSEEAREKLVNYYVELRKESTgKRKSIPITVRQLESLIRLSEAHA 305
                         330       340
                  ....*....|....*....|....*
gi 33356547   779 RIHLRDYVIEDDVNMAIRVMLESFI 803
Cdd:pfam00493 306 RLRLSEEVTEEDVEEAIRLILESLK 330
PTZ00111 PTZ00111
DNA replication licensing factor MCM4; Provisional
194-804 2.75e-86

DNA replication licensing factor MCM4; Provisional


Pssm-ID: 173403 [Multi-domain]  Cd Length: 915  Bit Score: 296.91  E-value: 2.75e-86
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  194 EIHHRFKNFLRTHVDSHGHNVFKE---------------RISDMCKENRESLVVNYEDLAARE----HVLAY------FL 248
Cdd:PTZ00111  87 ELSERFTNFLKNFTEFSDVLEFKDeqqskpeytelyylwKLMNFIKENLRDHSTGYSRILPFEvdlmHVYSFdkvlykLL 166
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  249 PEAPAELLQIFDEAALEVVLAMYPKYDRITN------HIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQL 322
Cdd:PTZ00111 167 VTFPADCIAELDKVLVKLFNELLSKHYSDLSlennsfFPRARLMNKPVSDCVGNLEPSMADSLVQFSGTVVRQTWIVPEI 246
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  323 SMVKYNC-----------NKCNF-VLGPFCQSQNQEvkPGSCPECQSAGPFEVNMEETIYQNYQRIRIQESPGKVAAGRL 390
Cdd:PTZ00111 247 TMACFRCrgqkkiglndyQPCTCeHYEYVIQGEVNE--PLLCNECNSKYTFELNHNMCVYSTKKIVKLLQSNSSLNNPDK 324
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  391 PRSKDAI--------------------LLADLVDSCKPGDEIELTGIYH------NNYDGSLNTAngFPVFATVIL---- 440
Cdd:PTZ00111 325 DGLDNSVdnsglngeiymkdnevinlnLYDDLIDSVKTGDRVTVVGILKvtpirtSTTRRTLKSL--YTYFVNVIHvkvi 402
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  441 ----ANHVAKKDNKVA-VGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEP------KNPGG 509
Cdd:PTZ00111 403 nstnANQPEKGLKYLGnENDFSDLQVYKILELSRNPMIYRILLDSFAPSIKARNNVKIGLLCQLFSGNKnssdfnKSPDA 482
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  510 KHKV---RGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQ-RHPVSREWTLEAGALVLADRGVCL 585
Cdd:PTZ00111 483 CYKVdnfRGIINVLLCGDPGTAKSQLLHYTHLLSPRSIYTSGKSSSSVGLTASIKfNESDNGRAMIQPGAVVLANGGVCC 562
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  586 IDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRD 665
Cdd:PTZ00111 563 IDELDKCHNESRLSLYEVMEQQTVTIAKAGIVATLKAETAILASCNPINSRYNKNKAVIENINISPSLFTRFDLIYLVLD 642
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  666 TVDPVQDEMLARFVVGSHVRHH--PSNKEEEGL--ANGSAAEPAMPNT---YGVEPLpqEVLKKYIIYAKERVHPKLNQM 738
Cdd:PTZ00111 643 HIDQDTDQLISLSIAKDFLLPHmtGSGNDEDTYdrSNTMHVEDESLRSekdYNKNDL--DMLRMYIKFSKLHCFPKLSDE 720
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  739 DQDKVAKMY------------------------SDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMA 794
Cdd:PTZ00111 721 AKKVITREYvkmrqgnfqtsnldelehaqedddDDLYYQSSGTRMIYVSSRMISSIIRISVSLARMRLSTVVTPADALQA 800
                        730
                 ....*....|....
gi 33356547  795 IRVM----LESFID 804
Cdd:PTZ00111 801 VQIVksstFQSLVD 814
PRK09862 PRK09862
putative ATP-dependent protease; Provisional
485-659 1.10e-06

putative ATP-dependent protease; Provisional


Pssm-ID: 182120 [Multi-domain]  Cd Length: 506  Bit Score: 50.75  E-value: 1.10e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  485 IYGHEDIKRGLALALFGGEpknpggkhkvrgdiNVLLCGDPGTAKSQFLKYI----------EKVSSRAIFTTgqgASAV 554
Cdd:PRK09862 193 VIGQEQGKRGLEITAAGGH--------------NLLLIGPPGTGKTMLASRIngllpdlsneEALESAAILSL---VNAE 255
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  555 GLTAYVQRHPV-----SREWTL--------EAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQ 621
Cdd:PRK09862 256 SVQKQWRQRPFrsphhSASLTAmvgggaipGPGEISLAHNGVLFLDELPEFERRTLDALREPIESGQIHLSRTRAKITYP 335
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
gi 33356547  622 ARCTVIAAANPI-GGRYD-------PSLTFSENVDLTEPIISRFDI 659
Cdd:PRK09862 336 ARFQLVAAMNPSpTGHYQgnhnrctPEQTLRYLNRLSGPFLDRFDL 381
TIGR00368 TIGR00368
Mg chelatase-related protein; The N-terminal end matches very strongly a pfam Mg_chelatase ...
485-659 8.15e-05

Mg chelatase-related protein; The N-terminal end matches very strongly a pfam Mg_chelatase domain [Unknown function, General].


Pssm-ID: 129465 [Multi-domain]  Cd Length: 499  Bit Score: 44.83  E-value: 8.15e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   485 IYGHEDIKRGLALALFGGEpknpggkhkvrgdiNVLLCGDPGTAKSQFLKYIEKV----SSRAIFTTGQGASAVGLTA-- 558
Cdd:TIGR00368 194 IKGQQHAKRALEIAAAGGH--------------NLLLFGPPGSGKTMLASRLQGIlpplTNEEAIETARIWSLVGKLIdr 259
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   559 --YVQR------HPVSREWTLEAGA------LVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARC 624
Cdd:TIGR00368 260 kqIKQRpfrsphHSASKPALVGGGPiplpgeISLAHNGVLFLDELPEFKRSVLDALREPIEDGSISISRASAKIFYPARF 339
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
gi 33356547   625 TVIAAANP-----IGGRYDPSLTFSENVD-----LTEPIISRFDI 659
Cdd:TIGR00368 340 QLVAAMNPcpcghYGGKNTHCRCSPQQISrywnkLSGPFLDRIDL 384
 
Name Accession Description Interval E-value
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
518-664 1.57e-04

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707  Cd Length: 151  Bit Score: 41.75  E-value: 1.57e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 518 NVLLCGDPGTAKSQFLKYIEKVSSRAIFTT-GQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQD 596
Cdd:cd00009  21 NLLLYGPPGTGKTTLARAIANELFRPGAPFlYLNASDLLEGLVVAELFGHFLVRLLFELAEKAKPGVLFIDEIDSLSRGA 100
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 33356547 597 RTSIHEAMEQQSISISKagivtslQARCTVIAAANPiggrydpsltfSENVDLTEPIISRFDILCVVR 664
Cdd:cd00009 101 QNALLRVLETLNDLRID-------RENVRVIGATNR-----------PLLGDLDRALYDRLDIRIVIP 150
MCM2_N pfam12619
Mini-chromosome maintenance protein 2; This domain family is found in eukaryotes, and is ...
73-182 7.06e-27

Mini-chromosome maintenance protein 2; This domain family is found in eukaryotes, and is typically between 138 and 153 amino acids in length. The family is found in association with pfam00493. Mini-chromosome maintenance (MCM) proteins are essential for DNA replication. These proteins use ATPase activity to perform this function.


Pssm-ID: 257167  Cd Length: 145  Bit Score: 108.20  E-value: 7.06e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    73 IGDGMERDYRAIPELDAYEAEGLaLDDEDVEELTASQREAAERAMRQRDREAgrgLGRMRRGLLYDSDEEDEE------R 146
Cdd:pfam12619  31 FGDNMERDYRANPELDRYDEDGL-DDESDYEELSAAARRAAEARLNRRDRLL---RRRRMPAAFLDDDDEDDGdfdltaQ 106
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 33356547   147 PARKRRQVERATEDGEEDEEMIE---SIENLEDLKGHSV 182
Cdd:pfam12619 107 PRRRRRQYDEDRDADDEDIDPLEeelSLEDLSDVKAASI 145
MCM_N pfam14551
MCM N-terminal domain; This family contains the N-terminal region of MCM proteins. This region ...
195-310 3.14e-26

MCM N-terminal domain; This family contains the N-terminal region of MCM proteins. This region is composed of three structural domains. Firstly a four helical bundle, secondly a zinc binding motif and thirdly an OB-like fold.


Pssm-ID: 258689  Cd Length: 117  Bit Score: 105.38  E-value: 3.14e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   195 IHHRFKNFLRTHVDShGHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKY 274
Cdd:pfam14551   1 IKRRFREFLREFKGG-GEPKYRDQLREMANREKRSLEVDLDDLREFDPELADALLENPQEYLPLFEEALKEVVLELDPFP 79
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 33356547   275 DRITNH--IHVRISHLPLVEELRSLRQLHLNQLIRTSG 310
Cdd:pfam14551  80 PELKRRkeIQVRFYNLPKVVSIRDLRSSHIGKLVSVEG 117
Mg_chelatase pfam01078
Magnesium chelatase, subunit ChlI; Magnesium-chelatase is a three-component enzyme that ...
485-659 4.16e-06

Magnesium chelatase, subunit ChlI; Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa.


Pssm-ID: 144608  Cd Length: 207  Bit Score: 47.12  E-value: 4.16e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   485 IYGHEDIKRGLALALFGGepknpggkHkvrgdiNVLLCGDPGTAKS---QFLKYI-------EKVSSRAIfttgqgASAV 554
Cdd:pfam01078   5 VKGQEQAKRALEIAAAGG--------H------NLLMIGPPGSGKTmlaKRLPGIlpplteqEALEVTAI------HSVA 64
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   555 GLTAyvQRHPVSR------EWTLEAGALV------------LADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGI 616
Cdd:pfam01078  65 GLGG--DGGLIRRrpfrapHHSASAAALVgggsiprpgeisLAHNGVLFLDELPEFSRRVLESLRQPLEDGEITISRARA 142
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|...
gi 33356547   617 VTSLQARCTVIAAANP--IGGRYDPSLTFSENVD--------LTEPIISRFDI 659
Cdd:pfam01078 143 KVTFPARFQLVAAMNPcpCGYLGDPDKRCRCTPRqirrylsrLSGPLLDRIDL 195
AAA_5 pfam07728
AAA domain (dynein-related subfamily); This Pfam entry includes some of the AAA proteins not ...
518-657 1.32e-04

AAA domain (dynein-related subfamily); This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.


Pssm-ID: 254388  Cd Length: 135  Bit Score: 41.51  E-value: 1.32e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   518 NVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWT-LEAGALVLADR--GVCLIDEFDKMND 594
Cdd:pfam07728   1 GVLLVGPPGTGKSELAERLAAALSNRPVFYVQLTRDTTEEDLKGRRNIDPGGAsWVDGPLVRAARegEIAVLDEINRANP 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 33356547   595 QDRTSIHEAMEQQSISISKAG-IVTSLQARCTVIAAANPIGgrydpsltFSENvDLTEPIISRF 657
Cdd:pfam07728  81 DVLNSLLSLLDERRLLLPEGGeLVKAAPDGFRLIATMNPLD--------RGLN-ELSPALRSRF 135
MCM smart00350
minichromosome maintenance proteins;
291-803 0e+00

minichromosome maintenance proteins;


Pssm-ID: 214631 [Multi-domain]  Cd Length: 509  Bit Score: 818.04  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    291 VEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSqNQEVKPGSCP--ECQSAGPFEVNMEET 368
Cdd:smart00350   2 PSSIRELRADHLGKLVRISGIVTRTSGVRPKLKRASFTCEKCGATLGPEIQS-GRETEPTVCPprECQSPTPFSLNHERS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    369 IYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNN-YDGSLNTANGFPVFATVILANHVAKK 447
Cdd:smart00350  81 TFIDFQKIKLQESPEEVPVGQLPRSVDVILDGDLVDKAKPGDRVEVTGIYRNVpYGFKLNTVKGLPVFATYIEANHVRKL 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    448 DNKVA-------VGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVL 520
Cdd:smart00350 161 DYKRSfedssfsVQSLSDEEEEEIRKLSKDPDIYERLARSLAPSIYGHEDIKKAILLLLFGGVHKNLPDGMKIRGDINIL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    521 LCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI 600
Cdd:smart00350 241 LCGDPGTAKSQLLKYVEKTAPRAVYTTGKGSSAVGLTAAVTRDPETREFTLEAGALVLADNGVCCIDEFDKMDDSDRTAI 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    601 HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVV 680
Cdd:smart00350 321 HEAMEQQTISIAKAGITTTLNARCSVLAAANPIGGRYDPKLTPEENIDLPAPILSRFDLLFVVLDEVDEERDRELAKHVV 400
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    681 GSHVRHHPSNKEEEGlangsaaepampntygvEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMAT--- 757
Cdd:smart00350 401 DLHRYSHPEEDEAFE-----------------PPLSQEKLRKYIAYAREKIKPKLSEEAADKLVKAYVDLRKEDSQTesr 463
                          490       500       510       520
                   ....*....|....*....|....*....|....*....|....*.
gi 33356547    758 GSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFI 803
Cdd:smart00350 464 SSIPITVRQLESIIRLSEAHAKMRLSDVVEEADVEEAIRLLRESII 509
MCM2 COG1241
Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, ...
213-840 0e+00

Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]


Pssm-ID: 224162 [Multi-domain]  Cd Length: 682  Bit Score: 644.01  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 213 NVFKERIsDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVE 292
Cdd:COG1241  17 LEYAENI-ILDKIINRSLEVDLSDLEEYDPELAGLLLENPEEIIPLFEKALDEIALLLFPEVDRSLKKIHVRFKNLPNRL 95
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 293 ELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFcQSQNQEVKPGSCPECQSA--GPFEVNMEETIY 370
Cdd:COG1241  96 SIRELRSEHIGKLVSVEGIVTRASEVRPRLKKAVFECPKCGREVEVE-QSEFRVEPPRECENCGKFgkGPLKLVPRKSEF 174
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 371 QNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVaKKDNK 450
Cdd:COG1241 175 IDFQKVKIQELPELVPGGELPRSIEVILEDDLVDSVRPGDRVKITGVVRIVPSRSLSGRRKGPVFEIYLEANSV-EKLDK 253
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 451 VAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKS 530
Cdd:COG1241 254 REEVEITEEDEEEIKELAKRPDIYDILIKSIAPSIYGHEDVKKAILLQLFGGVKKNLPDGTRIRGDIHILLVGDPGTAKS 333
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 531 QFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSIS 610
Cdd:COG1241 334 QLLKYVAKLAPRGVYTSGKGSSAAGLTAAVVRDKVTGEWVLEAGALVLADGGVCCIDEFDKMNEEDRVAIHEAMEQQTIS 413
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 611 ISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSN 690
Cdd:COG1241 414 IAKAGITATLNARCSVLAAANPKFGRYDPKKTVAENINLPAPLLSRFDLIFVLKDDPDEEKDEEIAEHILDKHRGEEPEE 493
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 691 KEEEglangsaaepamPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESM---ATGSIPITVRHI 767
Cdd:COG1241 494 TISL------------DGVDEVEERDFELLRKYISYARKNVTPVLTEEAREELEDYYVEMRKKSAlveEKRTIPITARQL 561
                       570       580       590       600       610       620       630
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 33356547 768 ESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLES----FIDTQKFSVMRSMRKTFARYlsFRRDNNELLLFILKQLV 840
Cdd:COG1241 562 ESIIRLAEAHAKMRLSDVVEEEDVDEAIRLVDFSlktvAVDPEKGKIDIDIIEPGKSK--SKRDKIEKVLDIIKELV 636
MCM pfam00493
MCM2/3/5 family;
460-803 0e+00

MCM2/3/5 family;


Pssm-ID: 249903 [Multi-domain]  Cd Length: 330  Bit Score: 547.16  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   460 DVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKV 539
Cdd:pfam00493   1 DEEEIKELAKDPDIYDKLARSIAPSIYGHEDVKKAILLQLFGGVKKNTPDGTRLRGDINVLLVGDPGTAKSQLLKYVAKL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   540 SSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTS 619
Cdd:pfam00493  81 APRAVYTSGKGSSAAGLTAAVVRDPDTGEWTLEAGALVLADGGVCCIDEFDKMNEEDRVAIHEAMEQQTISIAKAGIVAT 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   620 LQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGlang 699
Cdd:pfam00493 161 LNARCSVLAAANPIFGRYDPKKSVAENINLPPPLLSRFDLIFVLLDKPDEEKDERLAKHIVDLHRNGEPSVEESIE---- 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   700 saaepampntyGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESM-ATGSIPITVRHIESMIRMAEAHA 778
Cdd:pfam00493 237 -----------TEDYVDPELLRKYIAYARENIFPKLSEEAREKLVNYYVELRKESTgKRKSIPITVRQLESLIRLSEAHA 305
                         330       340
                  ....*....|....*....|....*
gi 33356547   779 RIHLRDYVIEDDVNMAIRVMLESFI 803
Cdd:pfam00493 306 RLRLSEEVTEEDVEEAIRLILESLK 330
PTZ00111 PTZ00111
DNA replication licensing factor MCM4; Provisional
194-804 2.75e-86

DNA replication licensing factor MCM4; Provisional


Pssm-ID: 173403 [Multi-domain]  Cd Length: 915  Bit Score: 296.91  E-value: 2.75e-86
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  194 EIHHRFKNFLRTHVDSHGHNVFKE---------------RISDMCKENRESLVVNYEDLAARE----HVLAY------FL 248
Cdd:PTZ00111  87 ELSERFTNFLKNFTEFSDVLEFKDeqqskpeytelyylwKLMNFIKENLRDHSTGYSRILPFEvdlmHVYSFdkvlykLL 166
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  249 PEAPAELLQIFDEAALEVVLAMYPKYDRITN------HIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQL 322
Cdd:PTZ00111 167 VTFPADCIAELDKVLVKLFNELLSKHYSDLSlennsfFPRARLMNKPVSDCVGNLEPSMADSLVQFSGTVVRQTWIVPEI 246
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  323 SMVKYNC-----------NKCNF-VLGPFCQSQNQEvkPGSCPECQSAGPFEVNMEETIYQNYQRIRIQESPGKVAAGRL 390
Cdd:PTZ00111 247 TMACFRCrgqkkiglndyQPCTCeHYEYVIQGEVNE--PLLCNECNSKYTFELNHNMCVYSTKKIVKLLQSNSSLNNPDK 324
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  391 PRSKDAI--------------------LLADLVDSCKPGDEIELTGIYH------NNYDGSLNTAngFPVFATVIL---- 440
Cdd:PTZ00111 325 DGLDNSVdnsglngeiymkdnevinlnLYDDLIDSVKTGDRVTVVGILKvtpirtSTTRRTLKSL--YTYFVNVIHvkvi 402
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  441 ----ANHVAKKDNKVA-VGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEP------KNPGG 509
Cdd:PTZ00111 403 nstnANQPEKGLKYLGnENDFSDLQVYKILELSRNPMIYRILLDSFAPSIKARNNVKIGLLCQLFSGNKnssdfnKSPDA 482
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  510 KHKV---RGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQ-RHPVSREWTLEAGALVLADRGVCL 585
Cdd:PTZ00111 483 CYKVdnfRGIINVLLCGDPGTAKSQLLHYTHLLSPRSIYTSGKSSSSVGLTASIKfNESDNGRAMIQPGAVVLANGGVCC 562
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  586 IDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRD 665
Cdd:PTZ00111 563 IDELDKCHNESRLSLYEVMEQQTVTIAKAGIVATLKAETAILASCNPINSRYNKNKAVIENINISPSLFTRFDLIYLVLD 642
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  666 TVDPVQDEMLARFVVGSHVRHH--PSNKEEEGL--ANGSAAEPAMPNT---YGVEPLpqEVLKKYIIYAKERVHPKLNQM 738
Cdd:PTZ00111 643 HIDQDTDQLISLSIAKDFLLPHmtGSGNDEDTYdrSNTMHVEDESLRSekdYNKNDL--DMLRMYIKFSKLHCFPKLSDE 720
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  739 DQDKVAKMY------------------------SDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMA 794
Cdd:PTZ00111 721 AKKVITREYvkmrqgnfqtsnldelehaqedddDDLYYQSSGTRMIYVSSRMISSIIRISVSLARMRLSTVVTPADALQA 800
                        730
                 ....*....|....
gi 33356547  795 IRVM----LESFID 804
Cdd:PTZ00111 801 VQIVksstFQSLVD 814
COG0714 COG0714
MoxR-like ATPases [General function prediction only]
475-791 6.12e-13

MoxR-like ATPases [General function prediction only]


Pssm-ID: 223786 [Multi-domain]  Cd Length: 329  Bit Score: 69.77  E-value: 6.12e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 475 EKIFASIAPSIYGHEDIKRGLALALFGGEPknpggkhkvrgdinVLLCGDPGTAKSQFLKYIEKVSSRAIFT-----TGQ 549
Cdd:COG0714  16 GKIRSELEKVVVGDEEVIELALLALLAGGH--------------VLLEGPPGVGKTLLARALARALGLPFVRiqctpDLL 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 550 GASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISIskaGIVTSLQARC--TVI 627
Cdd:COG0714  82 PSDLLGTYAYAALLLEPGEFRFVPGPLFAAVRVILLLDEINRAPPEVQNALLEALEERQVTV---PGLTTIRLPPpfIVI 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 628 AAANPI--GGRYdpsltfsenvDLTEPIISRFDIlcvvRDTVDPVQDEMLARFVVgshvrhhPSNKEEEGLANGSAAEPA 705
Cdd:COG0714 159 ATQNPGeyEGTY----------PLPEALLDRFLL----RIYVDYPDSEEEERIIL-------ARVGGVDELDLESLVKPV 217
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 706 MPntygveplPQEVLKKYIIYAKERVHPKLNqmdqDKVAKMYSDLRKESM-ATGSIPITVRHiesMIRMAEAHARIHLRD 784
Cdd:COG0714 218 LS--------DEELLRLQKEVKKVPVSDEVI----DYIVTLVAALREAPDvALGASPRASLA---LLAALRALALLDGRD 282

                ....*..
gi 33356547 785 YVIEDDV 791
Cdd:COG0714 283 AVIPDDV 289
PRK09862 PRK09862
putative ATP-dependent protease; Provisional
485-659 1.10e-06

putative ATP-dependent protease; Provisional


Pssm-ID: 182120 [Multi-domain]  Cd Length: 506  Bit Score: 50.75  E-value: 1.10e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  485 IYGHEDIKRGLALALFGGEpknpggkhkvrgdiNVLLCGDPGTAKSQFLKYI----------EKVSSRAIFTTgqgASAV 554
Cdd:PRK09862 193 VIGQEQGKRGLEITAAGGH--------------NLLLIGPPGTGKTMLASRIngllpdlsneEALESAAILSL---VNAE 255
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547  555 GLTAYVQRHPV-----SREWTL--------EAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQ 621
Cdd:PRK09862 256 SVQKQWRQRPFrsphhSASLTAmvgggaipGPGEISLAHNGVLFLDELPEFERRTLDALREPIESGQIHLSRTRAKITYP 335
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
gi 33356547  622 ARCTVIAAANPI-GGRYD-------PSLTFSENVDLTEPIISRFDI 659
Cdd:PRK09862 336 ARFQLVAAMNPSpTGHYQgnhnrctPEQTLRYLNRLSGPFLDRFDL 381
TIGR00368 TIGR00368
Mg chelatase-related protein; The N-terminal end matches very strongly a pfam Mg_chelatase ...
485-659 8.15e-05

Mg chelatase-related protein; The N-terminal end matches very strongly a pfam Mg_chelatase domain [Unknown function, General].


Pssm-ID: 129465 [Multi-domain]  Cd Length: 499  Bit Score: 44.83  E-value: 8.15e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   485 IYGHEDIKRGLALALFGGEpknpggkhkvrgdiNVLLCGDPGTAKSQFLKYIEKV----SSRAIFTTGQGASAVGLTA-- 558
Cdd:TIGR00368 194 IKGQQHAKRALEIAAAGGH--------------NLLLFGPPGSGKTMLASRLQGIlpplTNEEAIETARIWSLVGKLIdr 259
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547   559 --YVQR------HPVSREWTLEAGA------LVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARC 624
Cdd:TIGR00368 260 kqIKQRpfrsphHSASKPALVGGGPiplpgeISLAHNGVLFLDELPEFKRSVLDALREPIEDGSISISRASAKIFYPARF 339
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
gi 33356547   625 TVIAAANP-----IGGRYDPSLTFSENVD-----LTEPIISRFDI 659
Cdd:TIGR00368 340 QLVAAMNPcpcghYGGKNTHCRCSPQQISrywnkLSGPFLDRIDL 384
ChlI COG1239
Mg-chelatase subunit ChlI [Coenzyme metabolism]
570-674 1.16e-04

Mg-chelatase subunit ChlI [Coenzyme metabolism]


Pssm-ID: 224160 [Multi-domain]  Cd Length: 423  Bit Score: 43.93  E-value: 1.16e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 570 TLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPiggrydpsltfsENVDL 649
Cdd:COG1239 134 AFQPGLLARANRGILYVDEVNLLDDHLVDALLDVAAEGVNDVEREGISIRHPARFLLIGTMNP------------EEGEL 201
                        90       100
                ....*....|....*....|....*
gi 33356547 650 TEPIISRFDiLCVVRDTVDPVQDEM 674
Cdd:COG1239 202 RPQLLDRFG-LEVDTHYPLDLEERV 225
COG0606 COG0606
Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, ...
485-632 2.63e-04

Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]


Pssm-ID: 223679 [Multi-domain]  Cd Length: 490  Bit Score: 42.99  E-value: 2.63e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 485 IYGHEDIKRGLALALFGGepknpggkHkvrgdiNVLLCGDPGTAKSQFLK-------------YIE-------------- 537
Cdd:COG0606 181 VKGQEQAKRALEIAAAGG--------H------NLLLVGPPGTGKTMLASrlpgllpplsipeALEvsaihslagdlheg 246
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547 538 -KVSSRAIF-TTGQGASAVGLtayvqrhpVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAG 615
Cdd:COG0606 247 cPLKIHRPFrAPHHSASLAAL--------VGGGGVPRPGEISLAHNGVLFLDELPEFKRSILEALREPLENGKIIISRAG 318
                       170
                ....*....|....*..
gi 33356547 616 IVTSLQARCTVIAAANP 632
Cdd:COG0606 319 SKVTYPARFQLVAAMNP 335
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
518-632 6.48e-04

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 39.66  E-value: 6.48e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33356547    518 NVLLCGDPGTAKSQFLK----YIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLE-----AGALVLADR---GVCL 585
Cdd:smart00382   4 VILIVGPPGSGKTTLARalarELGPPGGGVIYIDGEDILEEVLDQLLLIIVGGKKASGSgelrlRLALALARKlkpDVLI 83
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*..
gi 33356547    586 IDEFDKMNDQDRtsiheAMEQQSISISKAGIVTSLQARCTVIAAANP 632
Cdd:smart00382  84 LDEITSLLDAEQ-----EALLLLLEELRLLLLLKSEKNLTVILTTND 125
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH