NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|16936522|ref|NP_003385.2|]
View 

protein Wnt-10b precursor [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
47-389 6.96e-151

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


:

Pssm-ID: 249596  Cd Length: 308  Bit Score: 432.05  E-value: 6.96e-151
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522    47 VCLTLSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGgrlPHHSAILKRGFRESAFSFSMLAA 126
Cdd:pfam00110   1 ICSKLPGLSRKQRRLCRRNPDVMASVGEGARLGIEECQHQFRNRRWNCSTLDSS---SVFGKILKRGTRETAFVYAISSA 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522   127 GVMHAVATACSLGKLVSCGCGWKGSGEqdrlrakllqlqalsrgksfphslpspgpgsspspGPQDTWEWGGCNHDMDFG 206
Cdd:pfam00110  78 GVVHAVTRACSEGNLESCGCDRSRRGR-----------------------------------SGEGGWEWGGCSDNIKFG 122
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522   207 EKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFID 286
Cdd:pfam00110 123 IRFSREFLDARERGRDARALMNLHNNEAGRKAVKRNMKTECKCHGVSGSCTLKTCWKQLPDFREVGDLLKEKYDGAIKVE 202
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522   287 THNRNSGAFQPRLRPRRL---SGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTRVER 363
Cdd:pfam00110 203 VNNRGKRRRLQRRNPKRKpptSTDLVYLEDSPDYCERNPSLGSLGTRGRECNKTSSGIDGCDLLCCGRGYNTRTVVVVER 282
                         330       340
                  ....*....|....*....|....*.
gi 16936522   364 CHCRFHWCCYVLCDECKVTEWVNVCK 389
Cdd:pfam00110 283 CNCKFHWCCYVKCKTCRETVEVYTCK 308
 
Name Accession Description Interval E-value
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
47-389 6.96e-151

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


Pssm-ID: 249596  Cd Length: 308  Bit Score: 432.05  E-value: 6.96e-151
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522    47 VCLTLSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGgrlPHHSAILKRGFRESAFSFSMLAA 126
Cdd:pfam00110   1 ICSKLPGLSRKQRRLCRRNPDVMASVGEGARLGIEECQHQFRNRRWNCSTLDSS---SVFGKILKRGTRETAFVYAISSA 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522   127 GVMHAVATACSLGKLVSCGCGWKGSGEqdrlrakllqlqalsrgksfphslpspgpgsspspGPQDTWEWGGCNHDMDFG 206
Cdd:pfam00110  78 GVVHAVTRACSEGNLESCGCDRSRRGR-----------------------------------SGEGGWEWGGCSDNIKFG 122
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522   207 EKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFID 286
Cdd:pfam00110 123 IRFSREFLDARERGRDARALMNLHNNEAGRKAVKRNMKTECKCHGVSGSCTLKTCWKQLPDFREVGDLLKEKYDGAIKVE 202
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522   287 THNRNSGAFQPRLRPRRL---SGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTRVER 363
Cdd:pfam00110 203 VNNRGKRRRLQRRNPKRKpptSTDLVYLEDSPDYCERNPSLGSLGTRGRECNKTSSGIDGCDLLCCGRGYNTRTVVVVER 282
                         330       340
                  ....*....|....*....|....*.
gi 16936522   364 CHCRFHWCCYVLCDECKVTEWVNVCK 389
Cdd:pfam00110 283 CNCKFHWCCYVKCKTCRETVEVYTCK 308
WNT1 smart00097
found in Wnt-1;
50-389 3.63e-117

found in Wnt-1;


Pssm-ID: 128408  Cd Length: 305  Bit Score: 345.84  E-value: 3.63e-117
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522     50 TLSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGggrLPHHSAILKRGFRESAFSFSMLAAGVM 129
Cdd:smart00097   1 SLPGLSRRQRRLCRANPDVMISVAEGAQEGIEECQHQFRFRRWNCSTLDN---ASVFGKVLRQGTRETAFVYAISSAGVA 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522    130 HAVATACSLGKLVSCGCgwkgsgeqDRLRakllqlqalsRGKSFPhslpspgpgsspspgpqDTWEWGGCNHDMDFGEKF 209
Cdd:smart00097  78 HAVTRACSEGELDSCGC--------DYRK----------RGRAGG-----------------RGWKWGGCSDNIDFGIRF 122
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522    210 SRDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIdTHN 289
Cdd:smart00097 123 SREFVDARERGKDARALMNLHNNEAGRLAVKKTMKRECKCHGVSGSCTVKTCWLQLPDFRKVGDYLKEKYDGASEV-EVD 201
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522    290 RNSGAFQPRLRPRRLSG----ELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTRVERCH 365
Cdd:smart00097 202 KRGTNKAPVPKNSTFKPptetDLVYLESSPDFCEKNPKTGSLGTQGRQCNKTSKGLDGCDLLCCGRGYNTRTVEVVERCN 281
                          330       340
                   ....*....|....*....|....
gi 16936522    366 CRFHWCCYVLCDECKVTEWVNVCK 389
Cdd:smart00097 282 CKFHWCCYVKCKQCRETVEKHTCK 305
 
Name Accession Description Interval E-value
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
47-389 6.96e-151

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


Pssm-ID: 249596  Cd Length: 308  Bit Score: 432.05  E-value: 6.96e-151
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522    47 VCLTLSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGgrlPHHSAILKRGFRESAFSFSMLAA 126
Cdd:pfam00110   1 ICSKLPGLSRKQRRLCRRNPDVMASVGEGARLGIEECQHQFRNRRWNCSTLDSS---SVFGKILKRGTRETAFVYAISSA 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522   127 GVMHAVATACSLGKLVSCGCGWKGSGEqdrlrakllqlqalsrgksfphslpspgpgsspspGPQDTWEWGGCNHDMDFG 206
Cdd:pfam00110  78 GVVHAVTRACSEGNLESCGCDRSRRGR-----------------------------------SGEGGWEWGGCSDNIKFG 122
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522   207 EKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFID 286
Cdd:pfam00110 123 IRFSREFLDARERGRDARALMNLHNNEAGRKAVKRNMKTECKCHGVSGSCTLKTCWKQLPDFREVGDLLKEKYDGAIKVE 202
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522   287 THNRNSGAFQPRLRPRRL---SGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTRVER 363
Cdd:pfam00110 203 VNNRGKRRRLQRRNPKRKpptSTDLVYLEDSPDYCERNPSLGSLGTRGRECNKTSSGIDGCDLLCCGRGYNTRTVVVVER 282
                         330       340
                  ....*....|....*....|....*.
gi 16936522   364 CHCRFHWCCYVLCDECKVTEWVNVCK 389
Cdd:pfam00110 283 CNCKFHWCCYVKCKTCRETVEVYTCK 308
WNT1 smart00097
found in Wnt-1;
50-389 3.63e-117

found in Wnt-1;


Pssm-ID: 128408  Cd Length: 305  Bit Score: 345.84  E-value: 3.63e-117
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522     50 TLSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGggrLPHHSAILKRGFRESAFSFSMLAAGVM 129
Cdd:smart00097   1 SLPGLSRRQRRLCRANPDVMISVAEGAQEGIEECQHQFRFRRWNCSTLDN---ASVFGKVLRQGTRETAFVYAISSAGVA 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522    130 HAVATACSLGKLVSCGCgwkgsgeqDRLRakllqlqalsRGKSFPhslpspgpgsspspgpqDTWEWGGCNHDMDFGEKF 209
Cdd:smart00097  78 HAVTRACSEGELDSCGC--------DYRK----------RGRAGG-----------------RGWKWGGCSDNIDFGIRF 122
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522    210 SRDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIdTHN 289
Cdd:smart00097 123 SREFVDARERGKDARALMNLHNNEAGRLAVKKTMKRECKCHGVSGSCTVKTCWLQLPDFRKVGDYLKEKYDGASEV-EVD 201
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16936522    290 RNSGAFQPRLRPRRLSG----ELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTRVERCH 365
Cdd:smart00097 202 KRGTNKAPVPKNSTFKPptetDLVYLESSPDFCEKNPKTGSLGTQGRQCNKTSKGLDGCDLLCCGRGYNTRTVEVVERCN 281
                          330       340
                   ....*....|....*....|....
gi 16936522    366 CRFHWCCYVLCDECKVTEWVNVCK 389
Cdd:smart00097 282 CKFHWCCYVKCKQCRETVEKHTCK 305
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH