NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|223468672|ref|NP_001138607|]
View 

carnitine O-palmitoyltransferase 1, muscle isoform isoform a [Homo sapiens]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Carn_acyltransf pfam00755
Choline/Carnitine o-acyltransferase;
172-763 0e+00

Choline/Carnitine o-acyltransferase;


:

Pssm-ID: 250110  Cd Length: 592  Bit Score: 853.90  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  172 SLPKLPVPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQD-KTAPRLQKYLVLKSWWASNYVSDWWEEYIYLRGRSPL 250
Cdd:pfam00755   1 SLPKLPVPALEDTLDRYLESVKPLVNEEELERTKELVKEFVAgGIGERLQEYLLERAKKTDNWLSEWWLNYAYLAGRIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  251 MVNSNY-YVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALGIVPMCSYQMERMFNTTRIPGKDTDVLQHL 329
Cdd:pfam00755  81 PVNSSPgVVFPKHYFPDTEDQLRRAARIIHGILSFKLLLDREELKPEKAKGNTPLCMNQYYRLFNSCRIPGKPQDSIQNY 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  330 SDSR----HVAVYHKGRFFKLWLYEG-ARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGK 404
Cdd:pfam00755 161 FKSKnegsHVVVLCRGQFFKLDVLDSnGQLLTPDEIERQLAYILSDSSQSQPVEAPIGALTSEPRDEWAKARQKLFKDNP 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  405 -NKAALEAIERAAFFVALDEESYSYDPEDE--ASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPII 481
Cdd:pfam00755 241 iNQESLEKIESALFVVCLDDDSPPVGDEEKthSMLSMLHGGGLHGDGLNRWFDKSLQLIVFKNGSTGLNAEHSPADGIPV 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  482 GHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKALADDVELYCFQFLPFGKGLIKK 561
Cdd:pfam00755 321 VALCEFVYKVDEQTLKYTVEGLLVGSPSPSLPLPEKLEFDITPEIQNDIEKAKEQFDKLISDLDLVVLAFTNFGKGFIKK 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  562 CRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREGRTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQ 641
Cdd:pfam00755 401 CKLSPDAFIQLALQLAYYRLYGKLVPTYESASTRMFYHGRTETIRSVTTESLEFVQAMLDPSASKEEKIQLLKKACKAHV 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  642 NMYRLAMTGAGIDRHLFCLYLVSKYLGVSSPflAEVLSEPWRLSTSQIPQSqirmfdpEQHPNHLGAGGGFGPVADDGYG 721
Cdd:pfam00755 481 KYTKEAMTGKGIDRHLFGLKLLAKELGVEIP--ELFLDPSWSLSTSFVLST-------SQVPSELDIGGGFGPVVDDGYG 551
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|..
gi 223468672  722 VSYMIAgENTIFFHISSKFSSSETNAQRFGNHIRKALLDIAD 763
Cdd:pfam00755 552 ICYNIN-NDRIHFHISSFRSCPETDADRFAKYLEKALLDMKD 592
 
Name Accession Description Interval E-value
Carn_acyltransf pfam00755
Choline/Carnitine o-acyltransferase;
172-763 0e+00

Choline/Carnitine o-acyltransferase;


Pssm-ID: 250110  Cd Length: 592  Bit Score: 853.90  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  172 SLPKLPVPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQD-KTAPRLQKYLVLKSWWASNYVSDWWEEYIYLRGRSPL 250
Cdd:pfam00755   1 SLPKLPVPALEDTLDRYLESVKPLVNEEELERTKELVKEFVAgGIGERLQEYLLERAKKTDNWLSEWWLNYAYLAGRIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  251 MVNSNY-YVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALGIVPMCSYQMERMFNTTRIPGKDTDVLQHL 329
Cdd:pfam00755  81 PVNSSPgVVFPKHYFPDTEDQLRRAARIIHGILSFKLLLDREELKPEKAKGNTPLCMNQYYRLFNSCRIPGKPQDSIQNY 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  330 SDSR----HVAVYHKGRFFKLWLYEG-ARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGK 404
Cdd:pfam00755 161 FKSKnegsHVVVLCRGQFFKLDVLDSnGQLLTPDEIERQLAYILSDSSQSQPVEAPIGALTSEPRDEWAKARQKLFKDNP 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  405 -NKAALEAIERAAFFVALDEESYSYDPEDE--ASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPII 481
Cdd:pfam00755 241 iNQESLEKIESALFVVCLDDDSPPVGDEEKthSMLSMLHGGGLHGDGLNRWFDKSLQLIVFKNGSTGLNAEHSPADGIPV 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  482 GHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKALADDVELYCFQFLPFGKGLIKK 561
Cdd:pfam00755 321 VALCEFVYKVDEQTLKYTVEGLLVGSPSPSLPLPEKLEFDITPEIQNDIEKAKEQFDKLISDLDLVVLAFTNFGKGFIKK 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  562 CRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREGRTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQ 641
Cdd:pfam00755 401 CKLSPDAFIQLALQLAYYRLYGKLVPTYESASTRMFYHGRTETIRSVTTESLEFVQAMLDPSASKEEKIQLLKKACKAHV 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  642 NMYRLAMTGAGIDRHLFCLYLVSKYLGVSSPflAEVLSEPWRLSTSQIPQSqirmfdpEQHPNHLGAGGGFGPVADDGYG 721
Cdd:pfam00755 481 KYTKEAMTGKGIDRHLFGLKLLAKELGVEIP--ELFLDPSWSLSTSFVLST-------SQVPSELDIGGGFGPVVDDGYG 551
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|..
gi 223468672  722 VSYMIAgENTIFFHISSKFSSSETNAQRFGNHIRKALLDIAD 763
Cdd:pfam00755 552 ICYNIN-NDRIHFHISSFRSCPETDADRFAKYLEKALLDMKD 592
 
Name Accession Description Interval E-value
Carn_acyltransf pfam00755
Choline/Carnitine o-acyltransferase;
172-763 0e+00

Choline/Carnitine o-acyltransferase;


Pssm-ID: 250110  Cd Length: 592  Bit Score: 853.90  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  172 SLPKLPVPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQD-KTAPRLQKYLVLKSWWASNYVSDWWEEYIYLRGRSPL 250
Cdd:pfam00755   1 SLPKLPVPALEDTLDRYLESVKPLVNEEELERTKELVKEFVAgGIGERLQEYLLERAKKTDNWLSEWWLNYAYLAGRIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  251 MVNSNY-YVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALGIVPMCSYQMERMFNTTRIPGKDTDVLQHL 329
Cdd:pfam00755  81 PVNSSPgVVFPKHYFPDTEDQLRRAARIIHGILSFKLLLDREELKPEKAKGNTPLCMNQYYRLFNSCRIPGKPQDSIQNY 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  330 SDSR----HVAVYHKGRFFKLWLYEG-ARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGK 404
Cdd:pfam00755 161 FKSKnegsHVVVLCRGQFFKLDVLDSnGQLLTPDEIERQLAYILSDSSQSQPVEAPIGALTSEPRDEWAKARQKLFKDNP 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  405 -NKAALEAIERAAFFVALDEESYSYDPEDE--ASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPII 481
Cdd:pfam00755 241 iNQESLEKIESALFVVCLDDDSPPVGDEEKthSMLSMLHGGGLHGDGLNRWFDKSLQLIVFKNGSTGLNAEHSPADGIPV 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  482 GHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKALADDVELYCFQFLPFGKGLIKK 561
Cdd:pfam00755 321 VALCEFVYKVDEQTLKYTVEGLLVGSPSPSLPLPEKLEFDITPEIQNDIEKAKEQFDKLISDLDLVVLAFTNFGKGFIKK 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  562 CRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREGRTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQ 641
Cdd:pfam00755 401 CKLSPDAFIQLALQLAYYRLYGKLVPTYESASTRMFYHGRTETIRSVTTESLEFVQAMLDPSASKEEKIQLLKKACKAHV 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223468672  642 NMYRLAMTGAGIDRHLFCLYLVSKYLGVSSPflAEVLSEPWRLSTSQIPQSqirmfdpEQHPNHLGAGGGFGPVADDGYG 721
Cdd:pfam00755 481 KYTKEAMTGKGIDRHLFGLKLLAKELGVEIP--ELFLDPSWSLSTSFVLST-------SQVPSELDIGGGFGPVVDDGYG 551
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|..
gi 223468672  722 VSYMIAgENTIFFHISSKFSSSETNAQRFGNHIRKALLDIAD 763
Cdd:pfam00755 552 ICYNIN-NDRIHFHISSFRSCPETDADRFAKYLEKALLDMKD 592
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH