NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|285815680|tpg|DAA11572|]
View 

TPA: gag protein [Saccharomyces cerevisiae S288c]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.26e-54

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


:

Pssm-ID: 144563  Cd Length: 98  Bit Score: 177.17  E-value: 5.26e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285815680   17 ACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 285815680   97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.26e-54

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 144563  Cd Length: 98  Bit Score: 177.17  E-value: 5.26e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285815680   17 ACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 285815680   97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
PHA03247 PHA03247
large tegument protein UL36; Provisional
47-175 4.60e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 41.46  E-value: 4.60e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285815680   47 STKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANP-SGWSFYGHPSMIPYTPY--QMSPMYFP 123
Cdd:PHA03247 2894 STESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPtTDPAGAGEPSGAVPQPWlgALVPGRVA 2973
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 285815680  124 PgPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPML 175
Cdd:PHA03247 2974 V-PRFRVPQPAPSREAPASSTPPLTGHSLSRVSSWASSLALHEETDPPPVSL 3024
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
52-150 5.68e-04

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 40.91  E-value: 5.68e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285815680   52 SQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSgwsfyghpsmiPYTPYQMSPMYFPPGPQSQFP 131
Cdd:pfam09770 201 PGYPQPPQGHPEQVQPQQFLPAPSQAPAQPPLPPQLPQQPPPLQQPQF-----------PGLSQQMPPPPPQPPQQQQQP 269
                          90
                  ....*....|....*....
gi 285815680  132 QYPSSVGTPLSTPSPESGN 150
Cdd:pfam09770 270 PQPQAQPPPQNQPTPHPGL 288
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.26e-54

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 144563  Cd Length: 98  Bit Score: 177.17  E-value: 5.26e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285815680   17 ACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 285815680   97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
PHA03247 PHA03247
large tegument protein UL36; Provisional
47-175 4.60e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 41.46  E-value: 4.60e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285815680   47 STKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANP-SGWSFYGHPSMIPYTPY--QMSPMYFP 123
Cdd:PHA03247 2894 STESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPtTDPAGAGEPSGAVPQPWlgALVPGRVA 2973
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 285815680  124 PgPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPML 175
Cdd:PHA03247 2974 V-PRFRVPQPAPSREAPASSTPPLTGHSLSRVSSWASSLALHEETDPPPVSL 3024
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
52-150 5.68e-04

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 40.91  E-value: 5.68e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285815680   52 SQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSgwsfyghpsmiPYTPYQMSPMYFPPGPQSQFP 131
Cdd:pfam09770 201 PGYPQPPQGHPEQVQPQQFLPAPSQAPAQPPLPPQLPQQPPPLQQPQF-----------PGLSQQMPPPPPQPPQQQQQP 269
                          90
                  ....*....|....*....
gi 285815680  132 QYPSSVGTPLSTPSPESGN 150
Cdd:pfam09770 270 PQPQAQPPPQNQPTPHPGL 288
PHA03247 PHA03247
large tegument protein UL36; Provisional
56-149 1.31e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 39.92  E-value: 1.31e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285815680   56 TTPASSAVPENPHHASP--QPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMI----PYTPYQMSPMYFPPGPQSQ 129
Cdd:PHA03247 2755 ARPARPPTTAGPPAPAPpaAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPPAAVlapaAALPPAASPAGPLPPPTSA 2834
                          90       100
                  ....*....|....*....|
gi 285815680  130 FPQYPSSVGTPLSTPSPESG 149
Cdd:PHA03247 2835 QPTAPPPPPGPPPPSLPLGG 2854
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
53-146 1.65e-03

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 39.37  E-value: 1.65e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285815680   53 QQTTTPASSAVPENPHHASPQPASvpPPQNGPYPQQCMMTQNQanpsgwsfyGHPSMIPYTPYQMSPMYFPPGPQSQFPQ 132
Cdd:pfam09770 161 AQLQQRQQAPQLPQPPQQVLPQGM--PPRQAAFPQQGPPEQPP---------GYPQPPQGHPEQVQPQQFLPAPSQAPAQ 229
                          90
                  ....*....|....
gi 285815680  133 YPssvgTPLSTPSP 146
Cdd:pfam09770 230 PP----LPPQLPQQ 239
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
32-148 1.71e-03

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 39.37  E-value: 1.71e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285815680   32 PLDVSASKIQEYDKASTKANSQQTTTPAssAVPENPHHASPQPASVPPPQNgPYPQQCM----MTQNQANPSgwsfyGHP 107
Cdd:pfam09770 211 PEQVQPQQFLPAPSQAPAQPPLPPQLPQ--QPPPLQQPQFPGLSQQMPPPP-PQPPQQQqqppQPQAQPPPQ-----NQP 282
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 285815680  108 SMIPYTPYQMSPMYFPPGPQSQFPQYPSSVGTPLSTPSPES 148
Cdd:pfam09770 283 TPHPGLPQGQNAPLPPPQQPQLLPLVQQPQGQQRGPQFREQ 323
DUF605 pfam04652
Vta1 like; Vta1 (VPS20-associated protein 1) is a positive regulator of Vps4. Vps4 is an ...
58-170 5.56e-03

Vta1 like; Vta1 (VPS20-associated protein 1) is a positive regulator of Vps4. Vps4 is an ATPase that is required in the multivesicular body (MVB) sorting pathway to dissociate the endosomal sorting complex required for transport (ESCRT). Vta1 promotes correct assembly of Vps4 and stimulates its ATPase activity through its conserved Vta1/SBP1/LIP5 region.


Pssm-ID: 252721 [Multi-domain]  Cd Length: 312  Bit Score: 37.35  E-value: 5.56e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285815680   58 PASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTqnqanPSGWSFYGH-PSMIPYTPYQMSPmyfppgPQSQFPQYPSS 136
Cdd:pfam04652 176 PASASPSDPPSSSPGEPSFPSPPEGPDSPSDSSLP-----PAPSSFQSDtPPSSPEEPTNPSP------PPSPFAPSPPP 244
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 285815680  137 VGTPLSTPSPESGNTFTDSSSA--------DSDMTSTKKYVR 170
Cdd:pfam04652 245 QQQVPPLSTAKPSPPHTSATPApigpitpdDDAIAKAQKHAK 286
Med15 pfam09606
ARC105 or Med15 subunit of Mediator complex non-fungal; The approx. 70 residue Med15 domain of ...
29-171 7.97e-03

ARC105 or Med15 subunit of Mediator complex non-fungal; The approx. 70 residue Med15 domain of the ARC-Mediator co-activator is a three-helix bundle with marked similarity to the KIX domain. The sterol regulatory element binding protein (SREBP) family of transcription activators use the ARC105 subunit to activate target genes in the regulation of cholesterol and fatty acid homeostasis. In addition, Med15 is a critical transducer of gene activation signals that control early metazoan development.


Pssm-ID: 255446 [Multi-domain]  Cd Length: 768  Bit Score: 37.29  E-value: 7.97e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285815680   29 NQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPypqqcmmtqNQANPSGwsfyghPS 108
Cdd:pfam09606 394 NQGGLGANPMQQGQPGMMSSPSPVPQVQTNQSMPQPPQPSVPSPGGPGSQPPQSVS---------GGMIPSP------PA 458
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 285815680  109 MIPYTPYQMSPMyfpPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTK---KYVRP 171
Cdd:pfam09606 459 LMPSPSPQMSQS---PASQRTIQQDMVSPGGPLNTPGQSSVNSPANPQEEQLYREKYKqlsKYIEP 521
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH