NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|285810124|tpg|DAA06911.1|]
View 

TPA: gag protein [Saccharomyces cerevisiae S288c]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.27e-54

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


:

Pssm-ID: 144563  Cd Length: 98  Bit Score: 177.94  E-value: 5.27e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285810124   17 ACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENLHHASPQPASVPPPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 285810124   97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.27e-54

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 144563  Cd Length: 98  Bit Score: 177.94  E-value: 5.27e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285810124   17 ACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENLHHASPQPASVPPPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 285810124   97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
52-150 3.47e-03

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 38.60  E-value: 3.47e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285810124   52 SQQTTTPASSAVPENLHHASPQPASVPPPQNGPYPQQCMMTQNQANPSgwsfyghpsmiPYTPYQMSPMYFPPGPQSQFP 131
Cdd:pfam09770 201 PGYPQPPQGHPEQVQPQQFLPAPSQAPAQPPLPPQLPQQPPPLQQPQF-----------PGLSQQMPPPPPQPPQQQQQP 269
                          90
                  ....*....|....*....
gi 285810124  132 QYPSSVGTPLSTPSPESGN 150
Cdd:pfam09770 270 PQPQAQPPPQNQPTPHPGL 288
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
2-148 5.60e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 38.04  E-value: 5.60e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285810124   2 ESQQLSNYPHISHGSACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENlhHASPQPASVPPPQ 81
Cdd:PRK07764 635 APAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPA--QPAPAPAATPPAG 712
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 285810124  82 NGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPyQMSPMYFPPGPQSQFPQYPSSVGTPLSTPSPES 148
Cdd:PRK07764 713 QADDPAAQPPQAAQGASAPSPAADDPVPLPPEP-DDPPDPAGAPAQPPPPPAPAPAAAPAAAPPPSP 778
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.27e-54

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 144563  Cd Length: 98  Bit Score: 177.94  E-value: 5.27e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285810124   17 ACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENLHHASPQPASVPPPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 285810124   97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
52-150 3.47e-03

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 38.60  E-value: 3.47e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285810124   52 SQQTTTPASSAVPENLHHASPQPASVPPPQNGPYPQQCMMTQNQANPSgwsfyghpsmiPYTPYQMSPMYFPPGPQSQFP 131
Cdd:pfam09770 201 PGYPQPPQGHPEQVQPQQFLPAPSQAPAQPPLPPQLPQQPPPLQQPQF-----------PGLSQQMPPPPPQPPQQQQQP 269
                          90
                  ....*....|....*....
gi 285810124  132 QYPSSVGTPLSTPSPESGN 150
Cdd:pfam09770 270 PQPQAQPPPQNQPTPHPGL 288
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
2-148 5.60e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 38.04  E-value: 5.60e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 285810124   2 ESQQLSNYPHISHGSACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENlhHASPQPASVPPPQ 81
Cdd:PRK07764 635 APAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPA--QPAPAPAATPPAG 712
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 285810124  82 NGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPyQMSPMYFPPGPQSQFPQYPSSVGTPLSTPSPES 148
Cdd:PRK07764 713 QADDPAAQPPQAAQGASAPSPAADDPVPLPPEP-DDPPDPAGAPAQPPPPPAPAPAAAPAAAPPPSP 778
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH