NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|496670|emb|CAA55997|]
View 

A-438 protein [Saccharomyces cerevisiae]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TYA super family cl03073
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 3.28e-52

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


The actual alignment was detected with superfamily member pfam01021:

Pssm-ID: 144563  Cd Length: 98  Bit Score: 172.54  E-value: 3.28e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 496670      17 AYASVTSKEVSSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 496670      97 MASNWAHYQQPSMMTCSH 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 3.28e-52

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 144563  Cd Length: 98  Bit Score: 172.54  E-value: 3.28e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 496670      17 AYASVTSKEVSSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 496670      97 MASNWAHYQQPSMMTCSH 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
PRK10263 PRK10263
DNA translocase FtsK; Provisional
9-147 1.36e-05

DNA translocase FtsK; Provisional


Pssm-ID: 236669 [Multi-domain]  Cd Length: 1355  Bit Score: 46.23  E-value: 1.36e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 496670       9 NPHSLHGSAYASVTSKEVSSNQDPLaVSASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHvSPQPASVPPPQNGQYQQH 88
Cdd:PRK10263  720 NPFSLDDFEFSPMKALLDDGPHEPL-FTPIVEPVQQPQQPVAPQQQYQQPQQPVAPQPQYQ-QPQQPVAPQPQYQQPQQP 797
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 496670      89 GMMTPnkamasNWAHYQQPSmmtcshyQTSPAYYQP-DPHYPLPQYIPPLSTSSPDPIDS 147
Cdd:PRK10263  798 VAPQP------QYQQPQQPV-------APQPQYQQPqQPVAPQPQYQQPQQPVAPQPQDT 844
FAM222A pfam15258
Protein family of FAM222A; This protein family, FAM222A are a domain of unknown function. This ...
15-136 9.25e-03

Protein family of FAM222A; This protein family, FAM222A are a domain of unknown function. This family of proteins is found in eukaryotes and are typically between 411 and 562 amino acids in length. In humans, the gene encoding this protein domain lies in the position, chromosome 12 open reading frame 34.


Pssm-ID: 259392 [Multi-domain]  Cd Length: 503  Bit Score: 36.79  E-value: 9.25e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 496670      15 GSAYASVTSKEVSSNQDPLAV----SASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHVSPQPASVPPPQNGQYQQHGM 90
Cdd:pfam15258  59 GQRYSPYPSSQAGGKQGLLAIvkvpVKGVLKDFDGRRARLLPEAIMNPPVAPYAAPSTLNHPHPQALPVPQAQQHAQTLQ 138
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 496670      91 MTPNKAMASNWAHYQQPSMMTCSHYQTSPAYYQPDPHYPLPQYIPP 136
Cdd:pfam15258 139 HPPPSLQHPQALPQLQAQHPSLQHPQGLAAQQLQHAPPPPGLQGPR 184
ZipA COG3115
Cell division protein [Cell division and chromosome partitioning]
32-155 9.62e-03

Cell division protein [Cell division and chromosome partitioning]


Pssm-ID: 225657 [Multi-domain]  Cd Length: 324  Bit Score: 36.38  E-value: 9.62e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 496670    32 PLAVSASNLPEFDRDStkvnSQQETTPGTSAVPENHHHVSPQPASVPPPQNGQyQQHGMMTPNKAMASNWAHYQQPSMMT 111
Cdd:COG3115  39 PLKRMKSKRDDDPYDE----VADDEGVGEVRVVRKNEAPQFTQEHEAARQSPQ-HQYQPEYASAQIKIPVPQPPQISDPP 113
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....
gi 496670   112 CSHYQTSPAYYQPDPHYPLPQYIPPLSTSSPDPIDSQDQHSEVP 155
Cdd:COG3115 114 AHPQPTQPALDQEQPPEEARQPVLPQEAPAPQPVHSAAPQPAVQ 157
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 3.28e-52

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 144563  Cd Length: 98  Bit Score: 172.54  E-value: 3.28e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 496670      17 AYASVTSKEVSSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 496670      97 MASNWAHYQQPSMMTCSH 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
PRK10263 PRK10263
DNA translocase FtsK; Provisional
9-147 1.36e-05

DNA translocase FtsK; Provisional


Pssm-ID: 236669 [Multi-domain]  Cd Length: 1355  Bit Score: 46.23  E-value: 1.36e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 496670       9 NPHSLHGSAYASVTSKEVSSNQDPLaVSASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHvSPQPASVPPPQNGQYQQH 88
Cdd:PRK10263  720 NPFSLDDFEFSPMKALLDDGPHEPL-FTPIVEPVQQPQQPVAPQQQYQQPQQPVAPQPQYQ-QPQQPVAPQPQYQQPQQP 797
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 496670      89 GMMTPnkamasNWAHYQQPSmmtcshyQTSPAYYQP-DPHYPLPQYIPPLSTSSPDPIDS 147
Cdd:PRK10263  798 VAPQP------QYQQPQQPV-------APQPQYQQPqQPVAPQPQYQQPQQPVAPQPQDT 844
PRK10263 PRK10263
DNA translocase FtsK; Provisional
55-158 2.14e-05

DNA translocase FtsK; Provisional


Pssm-ID: 236669 [Multi-domain]  Cd Length: 1355  Bit Score: 45.46  E-value: 2.14e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 496670      55 ETTPGTSAVPENHHHVSPQPasVPPPQngQYQQhgmmtPNKAMASNWaHYQQPSMMTcshyQTSPAYYQPD-PHYPLPQY 133
Cdd:PRK10263  752 VQQPQQPVAPQQQYQQPQQP--VAPQP--QYQQ-----PQQPVAPQP-QYQQPQQPV----APQPQYQQPQqPVAPQPQY 817
                          90       100
                  ....*....|....*....|....*
gi 496670     134 IPPLSTSSPDPIDSQDQHSEVPQAK 158
Cdd:PRK10263  818 QQPQQPVAPQPQYQQPQQPVAPQPQ 842
PRK10263 PRK10263
DNA translocase FtsK; Provisional
53-155 3.60e-04

DNA translocase FtsK; Provisional


Pssm-ID: 236669 [Multi-domain]  Cd Length: 1355  Bit Score: 41.61  E-value: 3.60e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 496670      53 QQETTPGTSAVPENHHHVSPQPASVP-PPQNGQYQQHGMMTPNKAMASNWAHYQQPSMMTC-SHYQTSPAYYQP---DPH 127
Cdd:PRK10263  398 QQPVQPQQPYYAPAAEQPAQQPYYAPaPEQPAQQPYYAPAPEQPVAGNAWQAEEQQSTFAPqSTYQTEQTYQQPaaqEPL 477
                          90       100
                  ....*....|....*....|....*...
gi 496670     128 YPLPQYIPPLSTSSPDPIDSQDQHSEVP 155
Cdd:PRK10263  478 YQQPQPVEQQPVVEPEPVVEETKPARPP 505
FAM222A pfam15258
Protein family of FAM222A; This protein family, FAM222A are a domain of unknown function. This ...
15-136 9.25e-03

Protein family of FAM222A; This protein family, FAM222A are a domain of unknown function. This family of proteins is found in eukaryotes and are typically between 411 and 562 amino acids in length. In humans, the gene encoding this protein domain lies in the position, chromosome 12 open reading frame 34.


Pssm-ID: 259392 [Multi-domain]  Cd Length: 503  Bit Score: 36.79  E-value: 9.25e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 496670      15 GSAYASVTSKEVSSNQDPLAV----SASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHVSPQPASVPPPQNGQYQQHGM 90
Cdd:pfam15258  59 GQRYSPYPSSQAGGKQGLLAIvkvpVKGVLKDFDGRRARLLPEAIMNPPVAPYAAPSTLNHPHPQALPVPQAQQHAQTLQ 138
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 496670      91 MTPNKAMASNWAHYQQPSMMTCSHYQTSPAYYQPDPHYPLPQYIPP 136
Cdd:pfam15258 139 HPPPSLQHPQALPQLQAQHPSLQHPQGLAAQQLQHAPPPPGLQGPR 184
ZipA COG3115
Cell division protein [Cell division and chromosome partitioning]
32-155 9.62e-03

Cell division protein [Cell division and chromosome partitioning]


Pssm-ID: 225657 [Multi-domain]  Cd Length: 324  Bit Score: 36.38  E-value: 9.62e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 496670    32 PLAVSASNLPEFDRDStkvnSQQETTPGTSAVPENHHHVSPQPASVPPPQNGQyQQHGMMTPNKAMASNWAHYQQPSMMT 111
Cdd:COG3115  39 PLKRMKSKRDDDPYDE----VADDEGVGEVRVVRKNEAPQFTQEHEAARQSPQ-HQYQPEYASAQIKIPVPQPPQISDPP 113
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....
gi 496670   112 CSHYQTSPAYYQPDPHYPLPQYIPPLSTSSPDPIDSQDQHSEVP 155
Cdd:COG3115 114 AHPQPTQPALDQEQPPEEARQPVLPQEAPAPQPVHSAAPQPAVQ 157
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH